KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_CH21800Help
Entry
RG540_CH21800     CDS       T03244                                 

Definition
(GenBank) D-Ala-D-Ala ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Pathway
ngg00473  D-Alanine metabolism
ngg00550  Peptidoglycan biosynthesis
ngg01100  Metabolic pathways
ngg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ngg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RG540_CH21800
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RG540_CH21800
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    RG540_CH21800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ngg01011]
    RG540_CH21800
Enzymes [BR:ngg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RG540_CH21800
Peptidoglycan biosynthesis and degradation proteins [BR:ngg01011]
 Precursor biosynthesis
  Amino acid ligase
   RG540_CH21800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 GARS_A ATP-grasp_3 ATPgrasp_ST ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CDN48348
UniProt: A0A068SQ52
LinkDB All DBs
Position
complement(2148726..2149652)
Genome map
AA seq 308 aa AA seqDB search
MSDKHVAVLMGGFSSERPVSLSSGTACADALEGEGYRVTRVDVGRDVAAVLSELRPDVAF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMDKHQAKHVAKASGIPVAEAKAMSR
FDIGNAHPMKPPYVVKPVREGSSFGVVIVQENQSHPPQIIGSSEWRYGDRVLVERYVYGR
ELTCGVMGDVALGVTEVVPLSHAFYDYDAKYAEGGSKHVIPAQISPNIYQKIQTLALKAH
QAMGCRGVSRSDFRYDDRFSENGEVIWLEINTQPGMTPTSLVPEMAGHAGHSFGELVRWM
VEDATCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaagcacgtggctgttttgatgggagggttttcctccgagcggcctgtcagc
ctgtcctcgggcactgcctgcgcggatgctctcgaaggcgaaggctaccgcgtcacccgc
gtcgatgtcggccgggatgtggcggccgtcctctctgagcttcggccggacgtcgccttc
aacgccttgcatgggcctttcggcgaagacgggacgatccagggcattctcgaatatctc
gaaattccctatacccattccggcgtgctcgcgtctgcgctcgccatggacaagcatcag
gccaaacatgttgccaaggcgtccggcattccggtcgccgaagccaaggcgatgagccgg
ttcgatatcggcaatgctcatccgatgaagccgccttacgtggtgaagccggtccgcgag
gggtcgtccttcggtgtcgtgatcgtccaggaaaatcagtcgcatccgccgcaaattatc
ggttcgtccgagtggcgctacggcgatcgggttctggtcgagcggtatgtctatggccgc
gagctcacctgcggcgtgatgggcgatgtggcgcttggggttaccgaagtggtgccgctt
agccacgctttttacgattacgacgcgaaatatgcggagggtggttcgaaacacgtcatt
ccggcgcaaatttcaccgaatatttaccaaaagattcaaacactagcgcttaaggcgcat
caggcgatgggctgccgtggcgtcagtcgctccgactttcgctacgacgaccgcttctcc
gagaacggcgaggtcatctggctggaaatcaatacgcagccgggcatgaccccgacatcc
ttggtgcccgaaatggccggccatgccggccactcatttggtgaactcgtccgttggatg
gtggaggacgctacgtgtttgcgttga

DBGET integrated database retrieval system