KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_CH22630Help
Entry
RG540_CH22630     CDS       T03244                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M XFP_N Peptidase_M75
Motif
Other DBs
NCBI-ProteinID: CDN48431
UniProt: A0A068SRQ2
LinkDB All DBs
Position
2246930..2250013
Genome map
AA seq 1027 aa AA seqDB search
MNKMSLDFLSGSTKLRGRTVSEAVFDFLRQKGIDRIFGNPGSTELPMFVNVPEDFSYVLG
LQESIVVAMADAYAQTTRKPAFVNLHSAAGLGHALGNIYTAYRNRAPLIITTGQQSRELL
PHDPFLFAESPTEFPKPYVKWACEPARAEDVPAAIARAYYMAMQAPRGPVMVSVPLSDWQ
AQAAPIAIRDVETVISAPASAIDDLARRLNDAREPVLVVGPGVDIDNAWDATVRLAEILQ
AKVWVSPLSSRCSFPERHPLFAGFLPAFQPKLANCLGDADLVLVLGAPAFTYHFAGSGPD
IPQGAELWLITDDPAQAASAVVGNAMVSNLRAATESLVYRLRCRAPRTDGPARTIPRLKT
PKGITQEFFYQTLADVRSPDSIVFEEAPGGRDALHDFFPIERPGGFFATASGGLGYALPG
SIGAALTKPEQPVIAVIGDGSSLYAIQSIWSAVEYDADLMIVILNNGGYKVLKAIAERSG
SGRIDGVDIGHMDFVKIAEAQGCKAVRCEKGEELSSCLRDLLKMKGPRLLEIILSEEETE
MNVAVRNEQVLKTPEKFFIGGEWVAPLGTNKLDVISPVTEEVLMSYPEASNADIDKAVAA
ARDAFDNGPWPRMTFKERAGYLRKVADLLTARLDEIANAWTTQVGAPIFLTKKLVGQNPG
LYNYYAGLIENDDFVDQRKRADGGEVRVVREPVGVCAAITPWNAPMVLLNYKVSAALAAG
CTIVAKPSPETPLDAYLLAECIEQAGIPKGVFNLVPAGREGGDYLVRHKGIDKVSFTGST
IAGKTIAAACADRLTRVSLELGGKSAAVLLDDADFAKALPALMVYSMPITGQVCFSLTRI
LVPESRKQEFIDLYVGAVKNIKVGDPSDPTTQMGPLTMARQLTRVEGYIAAGRAGGATVA
CGGGRPAGLDRGYFIEPTVFTDVTMDMKIAQEEIFGPVVSIISYKDDEEAVKIANDTTYG
LSGAVFTSDPERGYAFARRMRTGSVTVNGMIVDIHHPFGGFKQSGIGREGGPEGLENYFE
VKTIHMA
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatgtcgctggatttcctatccggcagcacgaagctgcgtggacggacggta
agcgaggcggttttcgactttctgagacagaagggtatcgatcggatttttggcaatccg
ggctcgaccgaactgccgatgttcgtcaacgtgccggaggatttctcctatgtgctcggc
ctgcaggaatcgatcgtcgtcgccatggccgacgcctatgcgcagacgacccgcaagccg
gcctttgtcaacctgcattcggccgccggcctcggccatgcgctcggcaatatctacacc
gcctatcgcaaccgcgcgcctctgatcatcaccaccggccagcagagccgtgagctgctg
ccgcacgatccgttcctgtttgccgaaagcccgacggagtttccgaagccttatgtgaaa
tgggcctgcgaaccggcccgcgccgaagacgtgccggccgccatcgcccgcgcctattac
atggcgatgcaggcaccgcgcggcccggtcatggtgtcggtcccgttgagcgactggcag
gcacaggcggccccgatcgcgatccgcgatgtggaaacggtgatcagcgccccggcctca
gcgatcgacgatctggcccgccggctgaacgatgcccgcgagccggtgctggtcgtcgga
ccgggcgtcgatatcgacaatgcctgggatgccaccgtgcggcttgcggaaatcctgcag
gcgaaagtctgggtgagcccgctgtcgtcccgctgcagctttccggagcgccatccgctg
tttgccggtttcctgccggccttccagccgaagctcgccaattgcctcggtgacgccgac
ctcgtgctggtgctcggcgcgccggccttcacctatcatttcgcgggctccggcccggac
atcccgcaaggtgccgaactctggctgatcaccgacgaccccgcccaggcggcgagcgcc
gtcgtcggcaacgccatggtctcgaacctgcgcgctgccacggaaagcctcgtctaccgc
ctgcgctgccgtgcgccgcgtaccgacggcccggcccgcaccattccgcgcctgaaaaca
ccgaagggcatcacccaggaattcttctaccagacgctggccgacgtccgttcgcctgat
agcatcgtcttcgaggaagcgccgggcggccgcgacgcgctgcacgacttcttcccgatc
gaacggcccggcggctttttcgcgaccgccagcggcggcttgggttatgccctgcctggc
tctatcggcgccgcattgaccaagccggaacagccggtcatcgccgtcatcggcgacgga
tcgagcctctatgccatccagtcgatctggtccgcggtcgaatacgatgccgatctcatg
atcgtcatcctcaacaacggcggctacaaggtcctgaaggcgattgccgaaagaagcggc
tccggccgcatcgacggcgtcgatatcggccacatggatttcgtgaagatcgccgaagcg
cagggctgcaaggccgttcgctgcgaaaagggcgaggaattgtcgtcatgcctgcgggac
cttctgaaaatgaaggggccgcggcttttggaaatcattctatcagaggaggagactgaa
atgaatgtcgctgtcagaaacgaacaggtcctgaaaacccccgaaaagttcttcatcggc
ggtgaatgggtcgcgccactcggcaccaacaagctcgacgtcatctcgccggtgaccgaa
gaagtgctgatgagctatccggaagccagcaacgccgatatcgacaaagccgttgccgcc
gcccgcgacgccttcgacaacggcccatggccgcgcatgaccttcaaggaacgcgccggt
tacctgcgcaaggtcgcagacctcctgaccgcccgcctcgacgagatcgccaatgcctgg
acgacccaggtcggcgcgccgatcttcctgaccaagaagctggtcggccagaacccgggt
ctctacaactactatgccggcctgatcgagaacgacgattttgtcgatcagcgcaagcgt
gccgatggcggcgaagtccgggtcgtgcgcgagccggtcggcgtctgcgccgcgatcacc
ccgtggaatgcgccgatggtgctgctgaactacaaggtctcggcagcgcttgccgccggc
tgcacgattgtcgcaaaaccctcgccggaaaccccgctcgacgcctatctgctcgccgaa
tgcatcgagcaggccggcattccgaagggcgtcttcaacctggtgccggccggccgcgaa
ggcggcgattacctcgttcgccacaaaggcatcgacaaggtctccttcaccggttcgacg
attgccggcaagaccatcgccgccgcctgcgccgatcgcctgacccgcgttagccttgaa
ctcggcggcaaatcggcagccgtgcttctcgacgacgccgatttcgccaaggccctgccg
gcgctgatggtctattccatgccgatcaccggccaggtctgcttctcgctgacccgcatc
ctggtgccggaatcccgcaagcaggaattcatcgacctttatgtcggcgcggtgaagaac
atcaaggtcggtgatccatctgatccgaccacccagatgggcccgctcaccatggcccgc
cagcttacccgcgtcgaaggttacatcgccgccggccgtgcaggcggtgcgacggttgcc
tgcggcggtggtcgcccggccggtctcgaccgcggctacttcatcgagccgaccgtcttc
accgacgtgacgatggacatgaagatcgcccaggaggaaatcttcggcccggtcgtctct
atcatcagctacaaggacgatgaggaagcggttaaaatcgccaacgacacgacatacggt
ctttccggcgcggtcttcacctccgatccggaacgcggttatgcgtttgcccgccgcatg
cggaccggcagcgttaccgtcaacggcatgatcgtcgacatccaccatccgttcggcggt
ttcaaacagtcaggcatcggccgcgaaggtggaccggaaggtctcgaaaactattttgag
gtcaagacgatccatatggcctga

DBGET integrated database retrieval system