KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_CH25860Help
Entry
RG540_CH25860     CDS       T03244                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Pathway
ngg00240  Pyrimidine metabolism
ngg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RG540_CH25860
Enzymes [BR:ngg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RG540_CH25860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: CDN48752
UniProt: A0A068SR26
LinkDB All DBs
Position
complement(2581978..2582559)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFHYATMNAGKSTMLLQASYNYRERGMRTAIFTASLDDRAGRGRVASRIGLSSDAI
PFEPSDDLFMGIEAMHREEPIACVFVDEAQFLSPEQVWQLARISDRVGIPVMTYGLRTDF
QGKLFPGSLELLAIADELREVRTICHCGRKATMVVRLDEDGKLVREGAQVDVGGSEKYVS
LCRRHWEDQMHCD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctttatttccactacgcgaccatgaacgccggcaagtcgaccatgctgctg
caggcttcctataactaccgagagcgcggcatgcgcacggcgatcttcacggcgtcgctg
gacgatcgcgccggccggggccgagtggcctcgcggatcgggctctcctccgacgccatt
cccttcgagccgtccgacgatctctttatgggcatcgaggcgatgcaccgggaggagccg
atcgcctgcgtgttcgtcgacgaggcgcagttcctgtcgcccgagcaggtctggcagctc
gcccggatttccgaccgggtcggcatcccggtgatgacctatggcttgaggaccgatttc
cagggcaagctgtttcccggctcgctggagctgctggcgatcgccgacgagctgcgcgag
gtgcgcaccatctgccattgcgggcgcaaggcgacgatggtggtgaggctcgacgaggac
ggcaagctggtgcgcgaaggtgcccaggtcgatgtcggcggcagcgaaaaatatgtttcg
ctctgccggcggcattgggaagatcagatgcattgcgattga

DBGET integrated database retrieval system