KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_CH28050Help
Entry
RG540_CH28050     CDS       T03244                                 

Definition
(GenBank) Maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Pathway
ngg00500  Starch and sucrose metabolism
ngg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RG540_CH28050
Enzymes [BR:ngg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RG540_CH28050
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RG540_CH28050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase DUF3459 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: CDN48971
UniProt: A0A068ST87
LinkDB All DBs
Position
2788241..2789902
Genome map
AA seq 553 aa AA seqDB search
MINDLWYKNAVVYCLSVETFMDANGDGIGDFQGLQRRLDYLSGLGVSAIWLMPFQTSPGR
DDGYDVSDYYNVDPRYGTLGDFVEFTHGAKQRGIRVLIDLVVNHTSNEHPWFQDARSDPK
SPYRDWYVWSDKKPANANEGMVFPGVQKTTWTHDEKAKQYYFHRFYEFQPDLNTSNPHVQ
AEILKIMGFWIQLGVSGFRMDAVPFVISEKGAEVKKPKEQFDMLRTFREFLQWRLGDSII
LAEANVVPKENLAYFGEDGDRMQMMFNFHVNQALFYALASADSRPLAKAINDTYERPATG
QWGLFLRNHDELDLGRLTEKQRQKVFSEFGPDKHMQLYDRGIRRRLAPMLQGDRRRLELA
YSLMFSLPGTPVIRYGDEIGMGDDLSLPERNCARTPMQWSTEPHGGFTKNDKPILPVISG
GPFGFEHLNVAHQRRDPNSMLNWMERLIRMRKEAPEIGWGECVTLETSDQGVLALRYDWR
NNSVLVVHNLHSTPVEVEFSVGLGDHGEKLIDIADGGNSKAEKNGKHTLLLDAYAYRWFR
VGGLDYLLKRKEV
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaacgacctctggtacaagaacgccgtcgtctattgcctctccgtcgagaccttc
atggatgccaatggcgacgggatcggggatttccagggcctgcagcggcggctggattat
ctctccggcctcggcgtcagcgccatctggctgatgccgttccagacctcgcccggccgc
gacgatggttacgatgtctccgactattacaatgtcgatccccgctacggcacgctcggt
gatttcgtcgaattcacccatggcgccaagcagcgcggcataagggtgttgatcgacctt
gtggtcaaccacacgtccaacgaacatccctggttccaggacgcccgcagcgatccgaaa
tccccctatcgcgactggtatgtctggtccgacaagaaacccgcgaatgccaacgagggc
atggtgtttccgggcgtccagaagaccacttggacccatgacgagaaggccaagcaatat
tactttcaccgcttctacgagttccagccggacctcaacacctccaacccgcatgtgcag
gcggagatcctgaagatcatggggttctggatccagctcggcgtgtccggtttccgcatg
gatgcggtacccttcgtgatctccgaaaagggcgccgaggtgaaaaagccgaaggagcag
ttcgacatgctccggacgtttcgcgaattcctgcaatggcggctcggcgacagcatcatc
cttgccgaagccaacgtcgtacccaaggagaacctcgcctatttcggcgaggacggcgac
cgcatgcagatgatgttcaacttccatgtcaaccaggcgctattctatgcgctcgcctcg
gccgatagccggccgctcgcaaaggcgatcaacgacacctatgagcgtcccgccaccggc
caatggggcctgttcctgcgcaatcacgacgaactcgatctcggccggctgaccgagaag
cagcgccagaaggtgttttcggaattcgggccggacaagcacatgcagctttacgaccgc
ggcatccgtaggcggctggcgccgatgctgcagggcgaccgccgccggctggagctagcc
tacagcctgatgttctcgctgcccggcacgccggtcatccgctatggcgacgagatcggc
atgggcgacgacctgtcactgccggagcgcaactgcgcccgcacgccgatgcaatggtcg
actgagccgcatggcggcttcaccaagaacgacaaaccgatcctgccggtcatcagtggc
ggaccgttcggtttcgagcacctgaacgtcgcccaccagcggcgcgatccgaactcgatg
ctgaactggatggaacgcctgatccgcatgcgcaaggaagcgccggaaatcggctggggc
gaatgcgtgacgctggagaccagcgaccagggcgtgctggcgctgcgctacgactggcgc
aacaattccgtgctggtcgtccacaacctgcattcgacaccggtcgaggtggagttctcg
gtgggtctcggcgaccatggcgaaaaactgatcgacatcgccgatggcggcaacagcaag
gccgagaaaaacggcaagcatacgctcctgctcgatgcctatgcctatcgctggttccgg
gtcggcggcctggattatcttctgaagcgcaaggaagtctga

DBGET integrated database retrieval system