KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_CH33090Help
Entry
RG540_CH33090     CDS       T03244                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Pathway
ngg03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ngg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    RG540_CH33090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ngg03400]
    RG540_CH33090
Enzymes [BR:ngg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RG540_CH33090
DNA repair and recombination proteins [BR:ngg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RG540_CH33090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: CDN49473
UniProt: A0A068STE9
LinkDB All DBs
Position
3304740..3307268
Genome map
AA seq 842 aa AA seqDB search
MALETYNQKRDFKASPEPQGKVSGRKAKASGNSFAIQKHDATRLHYDFRLEMDGVLKSWA
VTRGPSFVPGEKRLAVHVEDHPLDYGGFEGMIPKGNYGAGAVLLWDRGTWEPIGDPHKGY
KKGHMEFELKGEKLEGRWHLIRMARREGEKRENWLLVKGEDEFARAEGDKDILDEMPLSV
KSGKTLDEIWGRKAPPAKNTAKPKAKAKSDPEPEKSDIAASKIKGAKKAELPDFVEPQLA
TLVKSAPSGKRWVHEIKLDGYRLQARVADGKVTLLTRTGLDWTHKFGDEIIAEFGKLSPA
DAIIDGEVAVEAGSGATDFSLLQQDLSEGRDDRFTFYAFDILHLDGYDLTGATLLKRKEA
LETLLTGSGPALRYSEHFGDEGGLVLKHACRLSLEGIISKIADAPYRPGRGRDWVKSKCS
ARQEFVVAGFVPSSVSRTAIGSLVMGYYDKGKLRHAGRVGTGYSNAVAQSLLKRLQEIHT
GESPFDEKLAGVEKKDVVFVRPELVAEVEFRGWTADAHIRHAAFRGLREDKDPKDIVREG
GPVNVAEQPKPPKRTVNLTHPDRVYWPDAGVTKAGLADYYTEVWRLMAPFVVNRPLALVR
GPDGIGKPLFFQKHGWKGMTKNAVLVKDPTDPAEEDITIRDLDGLLGLVQGATLEIHPWG
STLDDWEKPDMVNIDLDPGEGVSWTDIIAAAHEVKRRFEDMGLVAFVKTSGGKGLHVVAP
VKPKAEWPEVKAAMKALADGMAGDDPDKYVSTITKSKRSGKILIDYLRNGRGNTAVAPYS
TRARPGAPVSMPVEWDELGGAIGPNYFTVNNAPARIAQQTNDPWGDFRKAEAPIEFKAKK
KR
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgaaacctataaccagaagcgggacttcaaggcttctcccgagcctcagggg
aaagtctccggccgcaaggccaaggcatccggcaacagtttcgccatccagaaacacgat
gccacccgcctgcactacgatttccggctggaaatggatggcgtcctgaaaagctgggcc
gtcacccgcggcccgagcttcgtgcctggcgaaaagcggcttgcggtgcatgtggaagac
catccgctcgactatggcggtttcgaaggcatgatcccgaaaggcaattacggcgccggc
gccgtgctgctctgggatcggggcacctgggaacccatcggcgatcctcacaagggctat
aagaaaggccatatggaattcgagctgaagggcgagaagctggagggccgctggcacctg
atccgcatggcccgcagagagggcgaaaaacgcgagaattggctgctggtaaaaggcgag
gacgagttcgcccgcgccgagggcgacaaggacattctcgacgaaatgccgctttcggtg
aagtcaggcaagacactggacgaaatctggggccgcaaggcaccgcctgcaaagaatacc
gccaaaccgaaagcgaaggcgaaatccgatccagaaccggaaaaatccgacattgctgca
tcgaagatcaaaggcgcgaagaaagccgaactcccggatttcgtcgaaccgcagcttgcg
accctggtgaagagtgcaccttccggcaaacgctgggtccatgagatcaagctcgatggc
tatcgcctgcaggcacgcgtcgcagacggcaaagtgacgctgctgacccgcacggggctc
gattggacgcataagttcggagacgagatcatcgcggaattcggaaagcttagcccggcc
gatgcgatcatcgacggggaagtagcggtcgaggccggttccggcgccaccgatttctcc
ctgcttcagcaggacctgagcgaaggtcgggacgaccggttcaccttctacgctttcgac
attcttcacctcgacggttacgacctgaccggtgcgacgcttctgaagcgcaaggaggcg
ctggaaacactgctaaccggcagcggtccagcccttcgctatagcgagcactttggcgac
gaaggcggactggtcctgaagcatgcctgccggctgagcctggaaggcatcatttccaag
atcgcggatgcgccctaccgccctggccgcggccgcgactgggtgaaatcgaaatgttcg
gcacgacaggaattcgtggtcgccggatttgtcccttcctccgtttcgaggacggcgatc
ggatcgctggtcatgggatattacgacaagggaaagctgcggcacgccggccgcgtcggc
acgggttattcgaacgccgttgcgcaatcgctcctcaaacgcctccaggagattcacacc
ggcgaaagcccgtttgacgaaaagcttgccggggtggaaaagaaggatgtcgttttcgtg
cggcccgaactggtggcggaagtggagttccgcggttggacggcggatgcgcatatccgc
cacgcggctttccggggcttgcgcgaagacaaggaccccaaggatatcgtccgggagggc
ggacctgtgaacgtagcggaacaaccgaagccgccgaagcggacggtcaatcttacccat
ccagaccgggtctactggccggatgccggagtgaccaaagccgggcttgcggattattac
accgaagtctggcggctgatggcgcccttcgtcgtgaaccgcccgctggcgctggtgcgt
gggccggatgggatcggtaaaccactcttcttccagaaacatggctggaagggcatgacc
aagaacgccgtgctcgtgaaggaccccaccgatccggcggaagaggatatcaccatccgt
gacctcgatggtttgctcggcctcgtccaaggagcgacgctggaaatccacccctggggc
tcgaccctcgacgactgggaaaagccggacatggtcaatatcgacctcgatccgggcgaa
ggcgtctcctggaccgatatcatcgctgccgctcatgaggtgaagcgtcgtttcgaggac
atggggctggtcgccttcgtaaaaacctcgggcggcaagggcctgcatgtcgtcgcaccg
gtcaaaccaaaggcagaatggccggaagtgaaggcggcgatgaaggcgctggccgacggc
atggccggcgacgatcccgacaaatatgtctcgacgatcaccaagtcgaagcgaagcggc
aaaatcctcatcgactacctgcgcaacggtcgcggcaatactgccgtcgccccctattct
acccgtgcccgccccggcgcaccggtgtccatgccggtcgagtgggacgaactcggcgga
gcgatcggccccaactatttcaccgtcaacaacgccccggcgcgcatcgcccagcagacg
aacgatccgtggggagattttcgcaaggcggaagccccgatcgagttcaaggcaaagaag
aagaggtag

DBGET integrated database retrieval system