KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_PA02710Help
Entry
RG540_PA02710     CDS       T03244                                 

Definition
(GenBank) Xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Pathway
ngg00040  Pentose and glucuronate interconversions
ngg00051  Fructose and mannose metabolism
ngg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RG540_PA02710
   00051 Fructose and mannose metabolism
    RG540_PA02710
Enzymes [BR:ngg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     RG540_PA02710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CDN50949
UniProt: A0A068SYM7
LinkDB All DBs
Position
pHAMBI540a:261493..262473
Genome map
AA seq 326 aa AA seqDB search
MPEPRFATRLNSFASKPKAEWPDLSGKPTMMQMATRAAKVEGLTDLDLNYPDHVADDPSL
LAGMIGDLGLAINGFAMRYYTNPAFKIGAFTNPDPAVRREAIDLTKKGIDAARAAGSNLM
TLWLGQDGFDYAFQANYHMLWQHEVDGIREVCAHDPDCQISIEYKPNEPRSYSLMPDCAT
TLLAIKDVDMPNLGVTLDFAHVLYADEQPAFAAALIARYSRLLGVHLNDGYAKRDDGLMV
GAVHAQQTIELLRQIRKDGYDGAIYFDTFPDMTGLDPVHECEVNIQTVKRMLTVVDRLEQ
DNRLSGAIDRQDAVSAQAVVQELMLG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaaccgagatttgcgacccgactgaattccttcgcctcgaagccgaaggccgaa
tggcctgatctttcgggcaagccgaccatgatgcagatggcgacgcgcgcagccaaggtc
gaaggtctgactgatctcgatctcaactatcccgaccatgttgccgacgatccgtcgctt
ctggccgggatgattggcgatctcggcctggcgatcaacggcttcgccatgcgttattat
accaatccggccttcaagatcggcgccttcaccaaccctgatccggcggttcgccgcgag
gcgatcgacttgacgaagaaaggcatcgacgcggcgcgcgccgccggcagcaacctgatg
acgctctggctcgggcaggatggcttcgattatgcctttcaggcgaactatcatatgtta
tggcaacacgaagtggatggaattcgtgaagtttgcgcccatgatcccgactgccagatc
agcatcgaatacaaaccgaacgagccacgctcctacagcctgatgcccgattgcgcgacc
acgcttcttgcgatcaaggacgtcgatatgcctaatctgggcgtgacgctggatttcgcc
catgtgctctatgccgacgagcagccggcctttgccgcagctctcatcgcccgatacagc
cggctcctcggcgttcatctcaacgacggctatgccaagcgcgacgacggcctgatggtc
ggcgcggtgcatgcccagcagacgatcgagcttctgcgtcagatccgtaaggacggctat
gacggcgcgatctatttcgacacgtttcccgatatgaccggtctcgatccggtccacgaa
tgcgaggtaaacatccagaccgtcaagcggatgctgacggtggtggatcgcctcgagcag
gacaaccgcctttccggggcgattgaccgacaggatgccgtatctgcgcaggccgttgtc
caggagttgatgctcggctga

DBGET integrated database retrieval system