KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_PA03480Help
Entry
RG540_PA03480     CDS       T03244                                 

Definition
(GenBank) Two component transcriptional regulator, winged helix family
  KO
K02483  two-component system, OmpR family, response regulator
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Brite
KEGG Orthology (KO) [BR:ngg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ngg02022]
    RG540_PA03480
Two-component system [BR:ngg02022]
 OmpR family
  Unclassified
   RG540_PA03480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CDN51026
UniProt: A0A068SYW9
LinkDB All DBs
Position
pHAMBI540a:346240..346980
Genome map
AA seq 246 aa AA seqDB search
MDHVDHILIVDDDREIRELVSSYLKKNGLRATVAADGRQMRSFLEANSVDLIVLDVMMPG
DDGLVLCRELRAGKHKATPVLMLTARSDEMDRIIGLEMGADDYLPKPFAARELLARIKAV
LRRTRMLPPNLQISEAGQLLTFGDWQLDTVGRHLLDKQGTEIALSGAEYRLLRVFIDHPQ
RVLNRDQILNLTQGRDADLFDRSIDLLVSRLRQRLGDDAREPTYIKTVRSEGYVFSVPVE
ISEPKP
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggatcatgtcgaccatatcctgatcgtcgatgacgaccgcgagatccgcgagctggtg
tcgagctatctgaaaaagaacggccttcgcgcgacggtggccgccgatggccgccagatg
cgcagtttcctcgaagccaattcggtcgacctgatcgtgctcgacgtgatgatgccgggc
gatgacgggctcgtgctttgccgcgaactcagggccggcaagcacaaggcgacgccggtc
ctgatgctgaccgcccgcagcgacgagatggaccggatcatcgggctcgaaatgggcgcc
gacgattatctgccgaaaccgtttgccgcacgcgagctgctggcgcgcatcaaggcggtc
ctgcgccggacgcggatgctgccgcccaacctgcagatcagcgaagccggccagttgctg
accttcggcgactggcagctcgatacggtcggtcgccatctgctcgacaaacagggcacg
gaaatcgccttgagcggcgccgaataccggctgctgcgcgttttcatcgaccatccgcag
cgcgtgttgaaccgcgaccagatcctcaacctcacccagggccgcgatgcggacctcttt
gaccgctcgatcgacttgcttgtgagccggcttcgccagcggctcggcgacgacgcgcgc
gagccgacctatatcaagacggtgcgcagcgaaggttacgtcttctcggttcccgtcgag
atttcggagccgaagccgtga

DBGET integrated database retrieval system