KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724403
Entry
103724403         CDS       T03372                                 

Gene name
Notch4
Definition
(RefSeq) notch 4
  KO
K20996  Notch 4
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04330  Notch signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103724403 (Notch4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103724403 (Notch4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103724403 (Notch4)
   05206 MicroRNAs in cancer
    103724403 (Notch4)
  09162 Cancer: specific types
   05224 Breast cancer
    103724403 (Notch4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103724403 (Notch4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103724403 (Notch4)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Ank Notch Ank_5 Ank_3 Ank_4 EGF_2 NODP NOD EGF_3 cEGF
Other DBs
NCBI-GeneID: 103724403
NCBI-ProteinID: XP_008819681
LinkDB
Position
Un
AA seq 1992 aa
MQPLFLLLLLLPLLTLMLRFPAVLTGERLCGGFPEPCANGGTCLSLSQGQVACRCAPGFL
GDTCQFPDPCLGTQICQNGGSCQALLPTPPGSSSPASSLPLRFSCTCPPGFTGERCQAQL
EELCPPSFCYQRGRCHIQVSGHPQCSCMPGWTGEQCQLRDFCSTNPCANGGQCLATYPQI
QCRCPPGFEGHTCEHDVNECFLEPGPCPKGTSCHNTLGSFQCLCPAGREGPQCKLRKGPC
PPEGCFNGGTCQLVPEGDATFHLCLCPPGFTGLDCEMNPDDCVWHQCQNGATCLDGLGTY
TCLCPKTWTGWDCSEDVDECEAQGLPRCRNGGTCQNLAGSFHCVCVSGWGGSSCEENLDD
CEAATCAPGSTCIDRVGSFTCLCPPGRTGLLCHLEDMCLSQPCHGDAQCNTNPLTGSTLC
LCQPGYSGPTCHQDLDECQIAQQGPSPCEHGGTCLNTPGSFNCLCPPGYTGSRCEANHNE
CLSQPCSPGSTCLDLLATFRCLCPPGLEGQLCEVEINECASDPCLNQASCHDLLNGFRCV
CLPGFTGARCEDDMDECSSSPCTNGGRCRDQPGAFSCECPPGFEGPQCETEVDECLSDPC
PTGASCLDLPGAFFCLCPSDFTGQLCEVPLCTPNLCQPEQKCQDQEDKGHCLCPDGSPGC
TPSEDSCTCHHGHCQRSSCVCDVGWTGPECDTELGGCISTPCAHGGTCHPQPSGYNCTCP
TGYTGPTCGEEATACHSGPCLNGGSCSTSPKGYSCTCPPSHTGPHCQTVIDHCVSTPCLN
GGTCVNRPGTSSCLCATGFQGPRCERRIRPSCTDSPCKNRATCQDTPQGPRCICPHGYTG
SSCQTLMDLCAQKACPHTARCLQSGPSFRCLCLQGWTGPLCDLPVSCQKAALSQGLEVSA
LCHNGGICIDRGASYFCRCPPGFQGKLCQDKMNPCESKPCQHGATCVVQPSGYLCQCAPG
YEGQNCSKELNACQSQPCHNHGTCTSKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPKG
TAACKSLANAFYCQCLPGHTGQRCEIDTDPCQSQPCTHGGSCEATAGLPPGFTCHCPKGF
QGPTCSHRAPSCGIHHCHHGGLCLPSPRQGLPPLCACLSGFGGPDCLTPPAPRGCGPPSP
CLHNGSCSETPGLGGPGFQCSCPPNSPGPRCQGPGAEGCEGRGGDGACDASCSGPEGNWD
GGDCSLGVPDPWKGCPSHSQCWLLFRDGRCHPQCNSEECLFDGYDCEMPPACTPAYDQYC
QDHFHNGHCEKGCNTAECGWDGGDCRPEDGDSEWGPSLALLVVLSPPALDQQLLALARVL
SLTLRVGLWVRKDSENRDMVFPYPGARAEEELRGTRDSSPQERQASHTQPMDKETDSLGA
GFVVVMGVDQSHCGPDHPASRCPWDSGLLLRFLAAMAAVGALEPLLPGPLLAAHPHAGTG
PPVNQLPWPVLCSPVAGVLLLAVGALLVLQLIRRRRREHGALWLPPGFTRRPGTQQAPHR
RRPPLGEDSIGLKALKPEVEVDEDGVAMCSGPEEGEEAEEPASKCHLWPLNSGCEELPQV
AMLTPPQECEIEVPGVNTCGPDGVTPLMSAICCGGVESRTVQGPWLGNPEPWGPLLDGGA
CPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAQEVCQ
LLLASRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAARADVGARDKRGKTALHWAAAV
NNARAARCLLQAGADKDAQDCREQTPLFLAAREGAMEVAQLLLELGATRGLRDQAGLAPS
DVARQRNHWDLLTLLEGVGLREARHKASPGCQAVARAHARTASLDGAPCGGGAVPRCRTL
SAGASSRGGRAGLPTRAWSVDLGARGGAAYARCRSRSGGSRGRGLPAGARGPRPSPAIVQ
GRPGVAAACGPLAPEQDWPRDWVALGACGPASSAHIPPPCLTPSPERGSPQVAWGLHIPP
VAPLNPGGGDQK
NT seq 5979 nt   +upstreamnt  +downstreamnt
atgcagcccctgttcctgctgctgctgctgctgccactgctgaccctgatgctgcgtttc
ccagctgtcctaaccggagagcggctgtgtggtggtttcccagaaccctgcgccaacgga
ggcacctgcctgagcctgtctcagggacaagtggcctgccggtgtgcccctggctttctg
ggtgacacgtgtcagttccctgacccctgcctgggtacccagatctgtcagaatgggggc
agctgccaagccctgcttcccacacccccaggctcctcgagccctgcttcttcactgccc
ctccgcttttcctgcacctgtccccctggcttcaccggcgagcggtgccaggcccagctg
gaagaactctgtccaccctccttctgttaccaaaggggccgctgccacatccaggtctca
ggtcacccacagtgctcctgtatgcccgggtggacaggtgagcaatgccaactcagagac
ttctgctcaaccaacccctgtgccaatggaggtcagtgcctggccacgtacccccaaatc
cagtgtcgctgcccacccggcttcgagggtcatacctgcgaacatgacgtcaacgagtgc
ttcctggagccaggaccctgccctaaaggcacctcctgccacaataccctgggctccttc
cagtgtctctgccctgcagggcgggagggtccccagtgcaagctccggaagggaccctgc
cctcctgagggctgtttcaatgggggcacctgccaactggtgccagaaggagatgccacc
tttcacctctgcctctgccccccaggtttcacaggcctggactgtgagatgaatccagat
gactgtgtctggcaccagtgtcagaatggagccacttgcctggatgggctgggtacctac
acctgcctctgcccaaagacctggacaggctgggattgctctgaagatgttgatgaatgt
gaggcccagggtctccctcgctgcagaaatggcggtacctgccagaacttggctggcagc
tttcactgtgtgtgtgtgagcggctggggaggctccagctgtgaggagaatttagacgac
tgtgaggctgccacctgtgcccccggatccacctgcattgaccgtgtgggctccttcacc
tgtctctgcccacctggacgcacaggcctcctgtgccacctggaagacatgtgcctgagc
cagccgtgtcatggagatgcccagtgcaacaccaatcctctgacgggctccaccctctgc
ttatgccagcctggctactcaggacccacctgtcaccaagacctggatgaatgtcaaata
gcccagcagggtcccagtccctgtgagcatggcggcacctgcctcaacacccctggctcc
tttaactgcctatgcccaccgggctacacgggctcccgctgcgaagccaatcacaacgag
tgcctgtcccagccctgcagcccgggcagcacctgcctggacctactggccaccttccgc
tgcctctgcccaccaggcttggaagggcagctctgtgaggtggagatcaatgagtgtgcc
tctgatccttgcctgaaccaagctagctgccatgacctgctcaatggcttccggtgtgtc
tgcctgcccggcttcactggtgccaggtgtgaggatgacatggacgagtgcagcagctcc
ccctgcaccaatggagggcgctgccgggaccagcctggagccttcagctgcgagtgtccc
ccaggctttgaaggaccacagtgtgagacagaggtggacgagtgtctgagtgacccctgc
cccactggagccagctgccttgatctcccaggagccttcttctgcctctgcccctctgac
ttcacaggtcagctctgtgaggttcccctgtgtacccccaacctgtgccaacctgagcag
aaatgccaagatcaggaagacaagggccactgcctctgccctgacggaagtcctggctgt
accccctctgaggacagctgcacctgccaccacgggcactgccaaagatcctcctgtgta
tgtgatgtgggttggaccggaccagaatgtgacacagagctcgggggctgcatctccaca
ccctgtgcccatggggggacctgccacccacaaccctctggctacaattgtacctgcccc
acaggctacacaggacccacctgtggtgaagaggcaacagcttgtcactcaggaccctgt
ctcaacggtgggtcctgcagcaccagtcccaaaggctactcctgcacctgccctccaagt
cacaccggtccccactgccaaactgtcattgaccactgtgtgtctaccccgtgcctcaat
gggggtacctgtgtgaataggcctggcacttcctcctgcctttgtgccacgggtttccag
ggcccacgctgtgagaggaggatccgccccagctgtacagacagtccctgtaagaacagg
gcaacctgccaggacacccctcaaggtccccgctgcatctgcccccatggatacaccgga
agcagctgccagactctgatggacctgtgtgcccagaaggcctgcccacacactgcccgc
tgcctccagagtgggccttccttccggtgcctgtgccttcagggatggacagggcccctc
tgtgacctcccagtgtcctgccagaaggctgcgctgagccaaggcctggaggtctctgcc
ctgtgccacaatggaggcatctgtattgacaggggggcctcttacttctgccgctgcccc
cctggattccaaggcaagctatgccaggataagatgaatccctgtgagtctaagccttgc
cagcatggagccacttgtgtggtccagcccagtgggtatctctgccagtgtgccccaggc
tatgaaggccagaactgctcaaaagaactcaatgcttgtcagtctcagccctgtcacaac
catgggacctgcacctccaaacctggaggtttccactgtgcctgccctccaggttttgtg
gggctacgctgtgagggggatgtggatgagtgtctcgaccagccctgccaccccaaaggc
actgcggcctgcaaatctctagccaatgccttctactgccagtgtctgcctggacacaca
ggccagaggtgtgagatagacacggacccctgccagagtcagccctgcacccatggaggg
tcctgtgaggccacagcaggactgccccctggtttcacctgccactgccccaagggtttc
caaggccccacctgcagccacagagccccttcctgcggcatccatcactgtcaccacggg
ggcctgtgtctgccctcccctaggcagggcttgccacccctctgtgcctgcctcagtggc
tttgggggccccgactgcctgacacctccagctcctcgaggctgtggacccccctcaccc
tgcctgcacaacggcagctgctcagagacccctgggctgggtggccctggttttcaatgt
tcctgccctcccaactctccagggccccggtgtcaggggccaggggcagaggggtgtgag
ggcagaggtggggatggagcctgtgatgctagctgcagtggtccagaaggaaactgggat
ggaggggactgctctctgggggtcccggacccctggaagggctgcccctcccactcccag
tgctggcttctgttccgggatggacggtgtcacccacagtgcaactctgaagagtgtctg
tttgatggctatgactgtgagatgccgccagcctgcaccccagcctatgatcaatactgc
caagatcacttccacaatgggcactgcgagaaaggatgcaacactgcagaatgtggctgg
gatgggggtgactgcagacctgaagatggggactcagagtgggggccctcccttgccctg
ctggtggtgctaagccccccagccctggaccagcagctacttgcgctggcccgagtgctg
tccctgactttgagggttgggctgtgggtgaggaaggacagtgagaacagggacatggta
ttcccctacccgggggcacgggccgaagaggagctgaggggaactcgggattcctctcct
caggagagacaagcctctcacacccagcctatggacaaggagacagactcccttggcgct
gggtttgtggtggtaatgggtgtggatcagtcccactgtggccctgaccaccctgcatcc
cgatgcccctgggactctgggctcctgctccgattccttgcagcgatggctgcagtggga
gccctggagcccctgctgcctggacccttgctggctgcccaccctcatgcaggcactggg
cccccagtcaaccaactcccctggcctgtactgtgctctccggtagctggggtgcttctc
ctggccgtcggggctcttcttgtcctccagctcatccgacgtcgccgtagagagcatgga
gccctgtggctgccccctggtttcactcgaaggcctgggacacagcaggcaccccaccgc
cggaggcccccactaggagaggacagcattggcctcaaggcgctgaagccagaggtggaa
gtcgatgaggatggagtggccatgtgctcaggccctgaggagggagaggaggctgaagaa
ccagcctccaagtgccatctctggccactgaacagcggctgtgaagagctcccacaggta
gccatgctgacgcctcctcaggagtgcgagattgaagttcctggggtgaacacctgtgga
cctgatggggtaacacccctgatgtcagcgatctgctgtgggggagtagagtccaggact
gtccaggggccatggctgggaaatcctgagccctggggaccactgctggatggaggggcc
tgtccccaggctcacaccgtgggcactggtgagacacccctgcacctggctgcccggttc
tccaggccaactgctgcccgtcgtctccttgaggctggagccaaccccaaccagcctgac
cgggcagggcggaccccacttcacaccgcagtggctgctgatgctcaggaggtctgccag
ctcctactagccagcagacagaccgcagtggatgcacgcacagaggacgggaccacacct
ttgatgctggctgccaggctggccgtggaggacctagttgaagaactgattgcagcccga
gctgacgtaggggccagagataaaagggggaaaacggcgctgcactgggccgcggccgtg
aacaatgcccgagccgcccgctgccttctccaggctggagccgataaagacgcccaggac
tgcagggagcagacgccgctgttcctggcggcgcgggaaggcgccatggaggtggcgcag
ctgttgctggagctcggggctacccgaggactgcgggaccaggccgggctggccccgagc
gacgtggctcgccagcgcaaccactgggacctgctgaccctgctggagggggtggggctg
cgggaggcacgtcacaaagcctcgccgggctgccaggcggtggctcgtgcgcatgcgcgc
accgcgtcattggacggcgctccgtgcgggggcggggctgtgccgcgctgccggacgctg
tcggccggagcaagctctcgggggggcagagccggcctcccaactcgggcttggtccgtg
gacttgggcgcgcgtggcggggccgcctacgcgcgctgccggagccgatccggaggctcc
cgcggccgtggacttcccgccggcgcgcgcgggcctcgccccagccctgcgatcgtgcag
gggaggcctggggtggcggccgcatgcggacctctggccccggagcaagactggccgcgc
gactgggtggccctgggagcctgcggccccgcctccagcgcccacatcccgcccccttgc
ctgactccgtccccggaacgcggatccccgcaagttgcgtggggtcttcatattccccca
gtagcacccttgaacccaggcggaggggatcagaagtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731622
Entry
103731622         CDS       T03372                                 

Gene name
Notch3
Definition
(RefSeq) notch 3
  KO
K20995  Notch 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04330  Notch signaling pathway
ngi04371  Apelin signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04919  Thyroid hormone signaling pathway
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103731622 (Notch3)
   04371 Apelin signaling pathway
    103731622 (Notch3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103731622 (Notch3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103731622 (Notch3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103731622 (Notch3)
   05206 MicroRNAs in cancer
    103731622 (Notch3)
  09162 Cancer: specific types
   05224 Breast cancer
    103731622 (Notch3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103731622 (Notch3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103731622 (Notch3)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Notch Ank Ank_2 NODP Ank_5 EGF_2 NOD Ank_3 Ank_4 DUF3454 cEGF EGF_3
Other DBs
NCBI-GeneID: 103731622
NCBI-ProteinID: XP_008828211
LinkDB
Position
Un
AA seq 2313 aa
MGPGARGRRRRRRLMALPPPPPPMRALPLLLLLLLAGPGAAAPPCLDGSPCANGGRCTQQ
PSREVACLCLPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCS
LPDPCLSSPCAHGARCSVGSDGRFVCSCPSGFQGRSCRSDVDECRVSGPCRHGGTCYNTP
GSFHCQCPGGYTGPLCENPVVPCAPSPCRNGGTCRQSGDVTYDCACLPGFEGQDCEVNVD
DCPGHQCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGH
SCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSN
PCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQ
CGRGYAGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPC
VNGGVCKDRVNGFSCSCPSGFSGSTCQLDVDECASTPCQNGAKCVDQPDGYECRCAEGFE
GTLCERNVDDCSPDPCHHGRCVDGIASFSCACASGYTGTRCESQVDECRSQPCRHGGKCL
DLVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEI
NECVSSPCREGGSCVDGENGFRCLCPPGFLPPLCLPPNHPCAHEPCSHGVCHDAPSGFRC
VCESGWSGPRCSQSLVPDACESQPCQAGGTCTSDGVGFHCTCPPGVQGRQCEVLSPCTPN
FCEHGGHCESDPGQLTICSCPLGWQGSRCQQDVDECAGPSPCGPRGTCTNLPGSFRCTCH
GGYTGPSCDQDIDDCEPNPCLNGGSCQDSVGSFSCSCLPGFAGPRCARDVDECLSSPCGP
GTCIDHVASFTCTCPPGYGGFHCEKDLLDCSPSSCFNGGTCVDGVNSFSCLCRAGYTGTH
CQYEADSCLSRPCLHGGICSPTHLGFQCACREGFTGSQCQTLVDWCSQVPCQNGGHCVQT
GAYCVCPLGWSGRHCDIQSLPCKEAASQMGVQLSQLCQAGGECVDDNHSHYCVCPEGRAG
SHCEQEVDPCAAQPCQHGGTCRGYMGGYVCECPVGYSGDSCEDDVDECASQPCQHGGSCI
DLVARYLCSCPPGTLGVLCEINEDDCGPSLDLGFRCLHNGTCVDLVGGFRCNCPSGYTGL
HCEADINECRPGVCHAAHTRDCLQDPGGHFHCLCHPGFTGPRCQTALSPCESQPCQHGGQ
CRPNPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPVGVPCQQTVRGPRCACPPGLS
GPSCRVSRASPSGNTNVSCTAAPCLHGASCLPTQIAPFFRCACTLGWTGPRCETPLAARE
VYEEPRCPRAACQAKRGDQHCDRECNSPGCGWDGGDCSLNVGDPWRQCEALQCWRLFNNS
RCDPACSSPACLYDNFDCYTSGHDRTCNPVYEKYCTDHFADGRCDQGCNTEECGWDGLDC
ASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDARGQAMVFPYHR
PNPGSRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDF
PYPLRDVRGEPLEPPEQSVPLLPLLVAGAIFLLVILVLGVMVARRKREHSTLWFPEGFAL
HKDIAAAHKGRREPVGQDALGMKSMAKGENLMGEVATDWMDTECPEAKRLKVEEPRAGAE
EPVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCGGA
LEPMPTEEDEADDASASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLDAG
ADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEGMV
EELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAARE
GSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPLGSHGLGPL
LCPPGAFLPGLKAVPSGAKKSRRPPGKAGLGPQGTRGRGKKLTLACPGPLADSSVTLSPV
DSLDSPRPFGGPPSSPGGFPLEGSYTTTATAVPFAQLGAGRPLGRQPPGGCVLSLGLLNP
VAVPLDWARLPPPAPPGPSFLLPLAREPQLLNPGTPVSPQERPPPYLAAQGHGEECPVVG
TQGSPTKARFLRVPSEHPYLTPSPESSEHWASPSPPALSDWSDSTPSPATATGATAPGAL
PAQAHPLSVPSLPQAQTQLGPQPEITPKRQVLA
NT seq 6942 nt   +upstreamnt  +downstreamnt
atggggccgggggcccgcggccgccgccggcgtcgtcgcctgatggccctgccaccgccg
ccaccgcccatgcgggctctgcccctgctgctgctgctgctgctagcggggccgggggct
gcagcccctccatgcctggatggaagcccgtgtgcaaatggaggccggtgtacccagcag
ccctctcgggaggttgcctgcctgtgtctgccaggctgggtaggtgagcggtgccagctg
gaagacccttgccactctggcccctgtgctggccgaggtgtctgtcagagttcagtggtg
gcaggcactgcccgcttctcctgccgttgcccccgaggcttccgaggcccagattgctcc
ctgccagatccctgcctcagcagcccctgtgcccatggtgcccgctgctcagtggggtca
gatggccgctttgtctgctcctgcccatctggcttccaaggtcgaagctgccgaagtgat
gtagatgagtgccgagtgagtgggccctgtcgccatggtggcacctgctacaatactcct
ggctccttccactgccagtgtccaggtggctacacagggccactgtgtgagaaccccgta
gtgccctgtgccccttccccatgtcgtaatggtggtacctgtaggcagagtggtgatgtc
acctatgactgtgcctgccttcctgggtttgagggccaggactgtgaagtcaatgtggat
gactgtcccggacatcagtgtctcaatgggggaacatgtgtggatggtgtcaacacctac
aactgccagtgtcctcctgagtggacaggccaattctgcacagaagatgtagatgaatgt
cagctgcagcccaatgcctgccacaatgggggcacctgcttcaacacgctgggtggccac
agctgtgtgtgtgtcaatggttggacaggtgagagctgcagtcagaatattgatgactgt
gccacggctgtgtgcttccatggggccacctgccacgaccgagtggcctctttctactgt
gcttgccccatgggcaagacaggcctcctgtgtcatctggatgatgcctgtgtcagtaac
ccctgtcatgaggatgctatctgtgacacaaaccctgtgaatggccgggcaatctgcacc
tgtccacctggtttcactggaggggcatgtgaccaggatgtggatgagtgctccattggt
gctaacccctgtgaacatctgggccgatgtgtgaacacacagggctcctttttgtgtcaa
tgtgggcgtggctacgctggacctcgctgtgaaactgatgtcaatgaatgtctctccggg
ccctgccgaaaccaggccacatgtcttgaccgcattggccagttcacctgcatctgcatg
gcaggtttcacaggaacctactgcgaggtggacatcgatgagtgtcagagtagcccatgt
gtcaatggtggtgtctgcaaggaccgggtcaatggcttcagttgttcctgcccttcaggc
ttcagcgggtccacgtgtcagctggatgtggatgaatgtgcaagcacaccttgccagaat
ggtgccaagtgtgtggaccaaccagatggctacgagtgtcgctgtgcagagggatttgaa
ggcaccttgtgtgagcgcaacgtcgacgactgctccccggacccctgccatcatgggcgc
tgtgtggatggtatcgccagcttctcctgtgcttgtgcctcaggctacacaggcactcgc
tgcgagagccaggtggatgagtgccgtagccagccctgccgccacgggggcaaatgccta
gacctggtggacaaatatctctgccgctgtcctccaggaaccacaggtgtgaactgtgaa
gtcaacattgatgactgtgccagcaacccctgcacctttggggtctgccgcgatggcatc
aaccgctatgattgtgtctgccagcctggctttacagggcccctctgcaatgtggagatc
aacgagtgtgtgtccagcccttgcagagagggtggatcctgtgtggatggggaaaatggc
ttccgctgcctctgcccaccaggctttctgcctccgctctgcctccctccaaaccatccc
tgtgcccatgagccctgcagtcacggtgtctgtcatgatgcacccagcgggttccgctgt
gtgtgtgagtctggttggagtggccctcgatgcagccagagtctggttccagatgcctgt
gagtcccagccctgccaggctggtggcacttgcaccagtgatggagtaggctttcactgc
acctgtccacctggagtccagggtcgacagtgcgaggtactgtccccctgcactccaaac
ttctgtgagcatgggggccactgcgagtctgaccctggccaactgactatctgctcctgt
cccctaggctggcaaggctcacgatgccagcaggatgtggatgagtgtgccggcccctca
ccctgtggcccccgtggtacctgcaccaacctacccgggagcttcaggtgcacctgccat
gggggctacactggcccttcctgtgatcaggacatcgatgactgtgaacccaacccatgc
ctcaatggtggttcctgtcaggacagcgtgggttccttttcctgctcttgccttcctggc
tttgctggtccacgctgcgctcgagatgtggatgagtgtttgagcagcccttgtggccca
ggcacctgcatagatcacgtggcctccttcacctgtacctgtccacctggctatggaggc
ttccactgtgagaaggacctgttggactgtagccccagctcctgcttcaatggaggtacc
tgtgtggatggggtgaactccttcagctgcttgtgccgtgctggctacacgggcacccac
tgccaatatgaggctgactcctgcctttcccggccctgtttgcatgggggcatctgcagt
cccacccacttagggtttcagtgtgcctgccgggagggcttcactgggagtcagtgccag
accctggtagactggtgcagccaggtgccctgtcagaatgggggtcattgtgtccagact
ggggcctactgtgtctgtcccctgggatggagcggccgccactgtgacatccaaagctta
ccctgcaaggaggctgcatcccagatgggggtgcagttgtcacagctgtgtcaggcaggt
ggggagtgtgtagatgacaaccactcccattactgtgtgtgcccagagggccgtgccggc
agtcactgtgaacaggaggtggacccctgtgcagcccagccctgccagcatgggggtacc
tgccgtggctacatggggggctatgtgtgtgagtgtccagtgggttattctggtgacagt
tgtgaggatgatgtagatgagtgtgcctcccagccctgccagcatgggggttcctgtatt
gaccttgtggcccgctatctctgttcctgtcctcctgggacactaggtgtactctgtgag
atcaacgaggatgactgtggtccatccttggacttgggcttccggtgcctacacaatggc
acctgtgtggatctggtgggtggtttccgctgtaactgtccctcaggatacacaggtctg
cattgcgaggcagatatcaatgagtgtcgcccaggtgtctgccatgcagcacatacccgg
gactgcctgcaagatccaggcggacactttcattgcctctgtcatcctggcttcacaggc
ccccgctgccaaactgccctgtctccttgtgagtcccagccatgccagcatggagggcag
tgccgtcccaacccaggccctggaggtgggttgaccttcacctgccactgtgcccagccg
ttctgggggccccgttgtgagcgtgtagcacgctcctgtcgagagctgcagtgtcccgtg
ggtgtcccatgccagcagactgtccgtgggccgcgttgtgcctgtcctccggggctgtcg
gggccctcttgccgagtctccagggcgtcaccctctggaaacactaacgtcagctgcaca
gctgccccctgtctgcatggggcctcgtgcctccctactcagatcgcccccttcttccgc
tgtgcgtgcactctgggctggactggcccgcgttgcgaaacccctttagctgctcgcgag
gtttacgaggagccgaggtgcccgcgagccgcctgccaggccaagcgtggggaccagcat
tgcgaccgggagtgcaacagccctggctgtggctgggacgggggcgactgttcgctgaac
gtgggcgatccttggcggcagtgtgaggcgctgcagtgctggcgtctcttcaacaacagc
cgatgcgaccctgcttgcagctctccggcctgcctctacgacaacttcgactgctacacc
agtggccatgaccggacttgcaacccggtgtatgagaagtactgtacggaccactttgca
gatggccgttgtgaccagggctgcaacacggaggagtgtggctgggatgggctagactgt
gccagcgaggtccctgcccttctggctcgcggtgtgctggtcctcacggttctcctgcct
ccggaagagctgctgcgctccagtgccgacttcctgcagcgactcagcgctattctgcgc
acctcgctgcgcttccgcttggatgcgcgtggccaggccatggttttcccctaccaccgg
ccaaatcctggctccagggcccggcgtgagctggctccagaggtgattggctctgtagtg
atgctggagattgacaacaggctctgtctgcagtcacctgagaatgaccactgcttcccc
gatgcccagagtgctgctgattacctgggagccttgtcagcagtggagcgcctcgatttc
ccatacccacttcgggatgtgcgaggggagcccctggagcctccagagcagagcgtgccg
ctgctgccactgctggtggcaggtgccatcttcctgctggtcatccttgtcctgggcgtc
atggtagcccgccgcaagcgcgagcatagcaccctctggttccccgagggttttgcattg
cacaaggacatagcagcagcccacaagggccggagggagcctgtgggacaagatgcattg
ggcatgaagagcatggccaagggcgagaatctgatgggggaggtggccacagactggatg
gacacggagtgccctgaggccaagcgactgaaggtagaggagcccagagcgggggctgag
gagcctgtggattgtcgacagtggacccagcaccatctggttgctgcagacatccgagtg
gcaccagccatggctctgactcctccacagggtgacgcagatgctgatggcatggatgtc
aatgtccgtggccctgatggcttcactccacttatgctggcctccttctgtgggggagcc
ctggaaccgatgcccactgaggaggacgaggccgatgatgcgtcagccagcatcatatca
gacctgatctgccagggagcccagcttggggcacggactgaccgcacaggcgagaccgcc
ctgcacctggctgcccgctatgcccgtgcagatgcggccaagcggctgctggatgctggg
gcagacaccaatgctcaggaccattcaggtcgcacccctcttcacacggctgtcactgct
gacgcccagggcgtcttccagattctcatcagaaaccgctctacagacctggatgcccgc
atggcagatggctccactgcactgatcttggcggcccgcctggcggtggagggcatggtg
gaagagctcattgccagtcatgctgatgtcaatgcagtggatgagctggggaaatcagcc
ttacactgggcagcagccgtaaacaatgtggaggccactttagctctgctgaaaaatggg
gccaacaaggacatgcaggacagcaaggaggagaccccactgttcctggctgcccgtgaa
ggcagctatgaggctgcgaagctgctgctggatcattttgccaaccgcgagatcacagat
cacctggacaggttgcctcgggatgtggcccaggaacggctacaccaggacattgtgcgg
ttattggaccagcccagtgggccacgcagcccacttggctctcatggcttggggcccctg
ctctgtccaccaggggccttcctacctggcctcaaggcggtgccatcaggggccaagaag
agcagaagacctccaggcaaggcgggtctggggccacaggggacccggggtcggggcaag
aagctgacactggcctgcccaggccccctggccgacagctctgtcacactgtcaccggtg
gactcgctggactccccacggcccttcggtgggcccccgtcttcccctggaggcttcccc
ctggaaggttcctataccaccacggccactgcagtgccctttgcacagcttggagcaggc
cgccctttgggacgccagcctcctggaggctgtgtgctcagcctgggcctgctcaaccct
gtggctgtcccccttgattgggcccggttgcctccacctgctcctccagggccctcattc
ctgctgcccctggctcgggaaccccagctgctcaacccagggactcccgtttctccccag
gagcggcccccaccctacctggctgcccagggacatggggaggaatgccctgtagtgggg
actcagggcagccccactaaggcccgcttcctgcgggttcccagcgagcatccctatttg
actccatcccctgagtcctcagagcactgggccagcccatcccctcctgccctctcagac
tggtccgactctacgcctagccccgcaactgccacgggtgccacagctcctggggctctg
cctgctcaggcacacccgctgtctgttccttcccttcctcaggcccagacccagctgggg
cctcagccagaaatcacacctaagaggcaggtgttggcctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732001
Entry
103732001         CDS       T03372                                 

Gene name
Notch2
Definition
(RefSeq) notch 2
  KO
K20994  Notch 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04330  Notch signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04919  Thyroid hormone signaling pathway
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103732001 (Notch2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103732001 (Notch2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103732001 (Notch2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103732001 (Notch2)
   05206 MicroRNAs in cancer
    103732001 (Notch2)
  09162 Cancer: specific types
   05224 Breast cancer
    103732001 (Notch2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103732001 (Notch2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103732001 (Notch2)
SSDB
Motif
Pfam: EGF hEGF EGF_CA EGF_2 DUF3454 Notch NOD Ank_2 Ank Ank_5 NODP Ank_3 Ank_4 cEGF EGF_3
Other DBs
NCBI-GeneID: 103732001
NCBI-ProteinID: XP_008828742
LinkDB
Position
Un
AA seq 2464 aa
MSVRQVKHIEGCSDYTVWAVQCRGGQEPCVNEGTCITYHNGTGYCKCPEGFLGEYCQHRD
PCEKNRCQNGGTCVTQAMLGKATCRCAPGFTGEDCQYPTSHPCFVSRPCLNGGTCHMRSR
DTYECTCQIGFTGKLCQWTDACLSHPCANGSTCTTVANQFSCRCPVGFTGQKCDTDINEC
DMPGRCQHGGTCLNLPGSYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTGDFAFEC
NCLPGFEGSTCDRNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQP
NACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCLCPE
GKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNP
CEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGF
KGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAK
CIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCVCNPGYMGAICSD
QIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLNCEINFDDCASNPCVHGACVDGINRY
SCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQVNECLS
SPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGSCDNLVNGYRCACKKG
FKGYNCQVNIDECASNPCLNQGACFDEINGYTCHCVLPYTGKNCQTVLAPCSPNPCENAA
VCKEAPNFESFTCLCAPGWQGQRCTIDIDECVSKPCMNHGLCHNTQGSYMCECPPGFSGV
DCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFIGDKCQTDMNECLSEPCKNGGTCSD
YVNSYTCKCPSGFDGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDI
NECNSHPCLNEGTCVDGLGTYRCTCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQEKAKSL
CLCPPGWDGAYCDVLNVSCKLAAFQKGVPEEHLCQHSGICINAGNTHHCQCPLGYTGSYC
EDQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLV
NHFKCSCPPGTRGLLCEENIDDCAGGPHCLNGGQCVDRIGGYSCRCLPGFAGERCEGDIN
ECLSSPCSSEGSLDCIQLTNDYQCVCRRAFTGRHCETFVDVCPQMPCLNGGTCAVASNMP
DGFICRCPPGFSGARCQSSCGQVKCRRGEHCVQTASGPRCFCPNPQDCDSGCASSPCQHG
GSCYPQRQPPYYSCRCSPPFWGSHCELSTVPGSAAPATCLSQYCADKARDGVCDEACNSH
ACQWDGGDCSLTMEDPWANCTSSLRCWEYINNECDELCNTAECLFDNFECQGSSKTCKYD
KYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLLPPEQLLQDSRSFL
RALGTLLHTNLRIKRDSQGALMVYPYYGEKPAALKKQRMARRSLPDEQEQEVAGSKVFLE
IDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVFSESEAPKSTQLLYLLAVAI
VVILFFILLGVIMAKRKRKHGFLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNLSVQASE
ANLIGSGTSEHWVDDEGPQPKKAKAEDEALLSEDDPIDRRPWTQQHLEAADIRRTPSLAL
TPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIITDLVYQGA
SLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQ
ILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSALHWAAAV
NNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHMDRLPR
DVARDRMHHDIVRLLDEYNVTPSPPGTVLASALSPVLCGPNRSFLSLKHTPMGKKSRRPN
AKSTVPTSLPNLAKEAKDIKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTYVSDTTSS
PMITSPGILQASPNPMLAAAAPTAPVHAQHALSFSNLHEMQPLAPGASTVLPSVSQLLSH
HHIVPPSSGSAGSSGRLHPVTVPTDWMHRMDVNEAQYNEMFGMVLAPAEGSHPGIAPQSR
PPEGKHITTQREPLPPIVTFQLIPKGSIAQAAGASQPQSNCPPPVAGPLPPMYQIPEMAH
LPSVAFPPAMMPQQDGQVAQTIVPTYHPFPASVGKYPTPPSQHSYASSNAAERTPNHSGH
LQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGSAGGGRRGPGTHMSEPPHSNM
QVYA
NT seq 7395 nt   +upstreamnt  +downstreamnt
atgtcagtgcgacaagtgaaacacattgaaggctgctcagattacaccgtctgggcagtg
cagtgtcgaggtggtcaagagccctgtgtaaatgaaggaacttgtattacttaccacaat
ggcacaggatactgcaaatgtccagaaggtttcttgggagaatattgtcagcatcgagac
ccctgtgagaagaaccgctgtcagaatggtggtacttgtgtgacccaggccatgttgggg
aaagccacctgccgatgtgctccagggttcacaggagaggactgccagtaccccacctcc
cacccctgctttgtgtctcgcccctgcctgaatggaggcacttgccacatgcgcagccgg
gacacctatgagtgcacctgccagatcggctttacagggaagctgtgccagtggacagat
gcctgcctgtctcatccttgtgcaaatggaagtacctgcaccacggtggccaaccagttc
tcctgcagatgtcccgtgggtttcacagggcaaaagtgtgatactgacatcaatgagtgt
gacatgccaggacgctgccagcatggtggcacctgcctcaaccttcccggttcttaccag
tgtcagtgtccccagggcttcacaggccagcattgtgacagcccctatgtgccctgcgca
ccctcgccctgtgtcaatggaggcacttgccggcagactggtgacttcgcttttgagtgc
aactgccttcccggttttgaagggagcacctgtgaccggaatattgatgactgtcctaac
cacaagtgtcagaatggaggggtttgtgtggatggggtcaatacttacaactgccgctgc
cctcctcagtggacaggacagttctgcacggaagatgtggatgagtgcctgctacaaccc
aatgcctgtcagaatggaggtacctgcaccaaccgcaatggaggctacggctgcgtgtgc
gtgaatggctggagcggagacgactgcagcgaaaacatcgatgactgtgcctttgcctct
tgcacgccagggtctacttgcattgaccgtgtggcctccttttcctgcctgtgtccagag
gggaaggcaggtctcctgtgtcatctggatgatgcctgcattagcaatccttgccacaag
ggggcgctgtgtgacaccaaccccctgaatgggcagtacatttgcacctgcccacagggc
tataagggggctgactgcacagaggatgtggatgagtgcgccatggccaacagcaatcct
tgtgagcatgcagggaagtgtgtgaacacagatggtgccttccattgtgaatgtctgaag
ggctacgcagggcctcgctgtgagatggacatcaatgagtgccactcagacccctgccag
aatgatgccacctgcctggataagattggaggcttcacatgtctgtgcatgccgggtttc
aaaggtgtgcattgtgagctggaggtgaatgaatgccagagcaacccttgtgtgaacaat
gggcagtgtgtggacaaagtcaatcgcttccagtgtctctgtccccctggtttcacaggg
cccgtgtgccagattgacatcgatgactgctccagcactccatgtctgaatggggccaag
tgcatcgatcaccccaatggctacgaatgccagtgtgccacaggtttcactggtgtgttg
tgtgaggagaacattgataactgtgacccagatccatgccaccatggccagtgccaggat
gggatcgactcctacacctgcgtttgcaaccctggatacatgggagccatctgcagtgac
cagattgatgagtgctacagcagcccttgcttgaatgatgggcgctgcatcgacctggtg
aatggctaccagtgcaattgccagcctggcacctcaggccttaattgtgaaattaatttt
gatgactgtgctagcaatccttgtgtgcacggagcttgtgtcgatggcatcaatcgttac
agttgtgtctgctctccaggattcacagggcagagatgtaacattgacattgatgagtgt
gcctccaatccctgtcgcaagggtgcgacatgcatcaacgacgtgaacggcttccgctgt
atatgccctgagggaccccatcatcccagctgctactcgcaggtgaatgagtgcttgagc
agtccctgcatccatggaaactgcactgggggcctcagtggctataagtgcctctgtgat
gcaggctgggttggcatcaactgtgaagtggacaaaaatgaatgtctgtctaacccgtgc
cagaatgggggaagctgtgacaacctggtgaatggatacaggtgtgcatgcaagaagggc
ttcaaaggctacaactgccaggtgaatattgatgaatgtgcctcaaatccatgtctgaat
caaggagcctgctttgatgaaattaatggctacacctgccactgtgtgttgccttataca
ggcaagaactgtcaaacagtgttggctccctgctccccaaacccttgtgagaacgcggct
gtttgtaaagaagcaccgaattttgagagtttcacgtgcttgtgcgctcctgggtggcaa
ggtcagagatgtactattgacattgatgagtgtgtctccaagccctgtatgaaccatggc
ctttgccataacacccagggcagctacatgtgtgagtgtccccccggctttagtggtgtg
gactgtgaggaggacatcgatgactgcctggccaatccttgccagaatggaggttcctgt
atggatggagtgaacactttctcctgcctgtgccttcctggtttcattggagataagtgc
cagacagacatgaatgagtgtctgagtgagccctgtaagaacggagggacctgctccgac
tacgtcaacagttacacctgcaagtgcccgtcggggttcgatggcgtgcactgcgaaaac
aacattgacgagtgcaccgagagctcctgtttcaatggtggaacatgtgtcgatgggatc
aactccttctcttgcttgtgccctgtgggcttcactggtcccttctgtctccacgatatc
aatgagtgcaactctcacccatgcctgaatgaggggacgtgcgttgatggcctgggtacc
taccgctgcacatgccccttgggctacactgggaaaaactgtcagaccctggtgaacctc
tgcagccggtctccatgcaaaaacaaaggtacttgtgttcaggagaaggcaaagtccctg
tgcctttgtccacctggatgggatggtgcatactgtgacgtgctcaacgtgtcctgtaaa
ctagcagccttccagaaaggcgtgcccgaggagcacttgtgtcagcactcgggcatctgt
atcaatgctggtaacactcatcactgccagtgcccgctgggctacacggggagctactgt
gaagaccagcttgatgagtgtgcctccaatccatgccaacatggtgccacctgcagcgac
ttcatcggaggatacagatgtgagtgtgttccagggtatcaaggtgtcaactgtgagtat
gaagtggatgagtgtcagaaccagccgtgccagaatggagggacctgcatcgaccttgtg
aaccacttcaagtgctcatgcccacctggcactcggggattgctttgtgaagagaacatt
gatgactgtgccggaggcccccattgtcttaatggtggccagtgtgtggaccgaatcggg
ggctacagttgtcgctgcttgcccgggtttgctggggagcgctgtgagggggacatcaac
gaatgcctgtccagcccctgcagctccgagggcagcctggactgcattcagctcaccaat
gactaccagtgtgtctgccgcagggccttcaccggccgccactgtgaaaccttcgtggat
gtgtgccctcaaatgccttgcctgaatggagggacttgtgctgtggccagcaacatgcct
gatggcttcatttgtcgttgtcccccaggcttctccggggcaagatgccagagcagctgt
ggccaagtgaagtgtaggagaggggagcactgtgtgcagactgcctctggcccccgctgt
ttctgccccaaccctcaggactgcgactcaggctgtgccagcagcccctgccagcacggg
ggcagctgctaccctcagcgccagcctccttactactcctgccgctgctccccaccattc
tggggtagccactgtgagctctccacagtccccggcagtgccgctcctgccacctgtctg
agtcagtactgtgccgacaaggctcgagatggcgtctgtgatgaggcctgcaacagccac
gcctgccaatgggatggaggggactgttccctcaccatggaggacccctgggccaactgc
acgtcatcgcttcgctgctgggagtacatcaacaacgagtgtgacgagctgtgcaacact
gcagagtgcctgtttgacaatttcgaatgccaggggagcagtaagacctgcaagtatgac
aaatactgtgcagaccacttcaaagacaaccactgtgaccagggatgcaacagcgaggag
tgtggctgggatggtctggactgtgctgcggaccagcccgagaacctggcggagggcacc
ctggttattgtggtgctcctgccccctgaacagctgctgcaggattctcgtagcttcttg
agggcactgggcaccctgctccacaccaacctgcgcattaaacgagactcacagggcgcc
ctcatggtgtatccctactacggagagaagccagctgccttgaagaagcagaggatggca
cgcaggtcgcttcctgatgagcaagagcaagaggtggctggctctaaggtatttctggaa
attgacaaccgccagtgtgttcaagattcagaccagtgcttcaagaacacagatgcagca
gctgctctcctggcttctcacgccatccaggggactctgtcgtaccctcttgtgtctgtc
ttcagtgaatccgaggctccaaaaagcactcagcttctctacctccttgctgtggccatt
gtcgtcatcctgttcttcatcctgctgggggtaatcatggccaaacgaaagcggaagcac
ggcttcctctggctgcctgagggtttcacccttcgtcgggactcaagcaatcacaagcgt
cgggagcctgtgggacaggatgctgtgggcctgaaaaatctctcagtgcaagcctcagag
gctaacctgattggttctggaacaagtgaacactgggtagatgatgaaggaccccagccg
aagaaagccaaggccgaagacgaggctttgctctcagaagatgacccgattgatcgtcgc
ccatggacacagcagcatcttgaagctgcagacatccgtcggaccccgtctctggctctt
actcctccacaggcagagcaggaggtggatgtgctagatgtgaatgtccgaggcccagat
ggctgtaccccattgatgttggcttctctccggggaggcagctcggatctgagtgatgaa
gatgaagatgcagaagactcctctgccaatatcatcacagacttggtctaccagggtgcc
agccttcaggcccagacagaccggactggtgaaatggccctccaccttgcagcccgctac
tcacgggctgatgctgccaagcgcctcctggatgcaggcgcagatgccaatgctcaggac
aacatgggccgctgccctctccatgccgcagtggcagcagatgcccagggtgtcttccag
attctgatccgcaaccgagtaactgatctggatgccagaatgaatgacggtaccaccccc
ctgatcctggcagcccgcctggctgtggagggaatggtggcagaactgatcaactgccaa
gctgacgtgaatgcagtggatgaccacggaaaatctgctctgcactgggctgctgctgtc
aataatgtggaggcgactcttctgctgctgaagaatggggccaatcgagacatgcaggac
aacaaggaagagacacctttgtttcttgctgcccgggagggaagttatgaagcagctaag
atcctgttagaccattttgccaatcgggacatcacagaccacatggaccgccttccccgg
gacgtggctcgggatcgcatgcaccatgacattgttcgcctcctggatgagtacaatgtg
acaccgagcccccctggcactgtgctggcttctgctctctcgcctgtcctctgtgggccc
aacaggtctttcctcagcctgaagcacaccccaatgggcaagaaatctagacggcccaac
gccaagagcactgtgcccactagcctccctaacctggccaaggaggccaaggatatcaag
ggaagcaggaggaagaagtctctgagcgagaaggtccagctgtctgagagctcagtgact
ttatcccctgtggactcgctagagtctccccacacatatgtttctgataccacgtcttct
cccatgatcacatcccctggaatcttacaggcttcacccaaccctatgctggccgcagct
gcccccactgccccagtgcatgcccagcatgcattgtctttctctaaccttcatgaaatg
cagcctttggctcctggagctagcacagtgcttccctcagtcagccagttgctgtcccac
caccacattgtccccccaagcagtggcagtgcaggaagctcgggcaggttgcatccagtc
actgttccaacagactggatgcaccgcatggatgtgaatgaggcccagtacaatgagatg
tttggcatggtcctggctcctgccgagggttcccaccctggcatagctccacagagcagg
ccacccgaagggaagcacatcaccacccaacgggagcctttgccccccattgtgactttc
cagcttatcccaaaaggcagcattgcccaggcagctggggcttcccagccgcagtctaac
tgccctccacctgtagcaggccctttgccccctatgtaccagatcccagagatggcccat
ttgcccagtgtggcttttccccctgctatgatgccccagcaggatgggcaggtagctcag
accattgttccaacctatcatcctttcccagcctcagtgggcaagtaccccacaccccct
tcccagcacagttatgcttcctcaaatgctgctgagcgaacacccaatcacagtggtcac
ctccagggtgagcatccctacctgacaccatccccggagtctcctgaccagtggtcaagc
tcatcaccacactctgcttctgactggtcagatgtgaccaccagccctactcctggaagt
gctggaggaggtcggcggggccctgggacacacatgtctgagccaccacacagcaacatg
caggtttacgcatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741215
Entry
103741215         CDS       T03372                                 

Gene name
Notch1
Definition
(RefSeq) notch 1
  KO
K02599  Notch 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04330  Notch signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04919  Thyroid hormone signaling pathway
ngi05020  Prion disease
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103741215 (Notch1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103741215 (Notch1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103741215 (Notch1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103741215 (Notch1)
   05206 MicroRNAs in cancer
    103741215 (Notch1)
  09162 Cancer: specific types
   05224 Breast cancer
    103741215 (Notch1)
  09164 Neurodegenerative disease
   05020 Prion disease
    103741215 (Notch1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103741215 (Notch1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103741215 (Notch1)
SSDB
Motif
Pfam: EGF hEGF EGF_CA EGF_2 NOD Notch Ank_2 Ank NODP DUF3454 Ank_5 Ank_3 Ank_4 EGF_3
Other DBs
NCBI-GeneID: 103741215
NCBI-ProteinID: XP_008840189
LinkDB
Position
Un
AA seq 2539 aa
MPRLLAPLLCLALLPALAARGLRCSQPGGTCLNGGRCEVANGTEACVCSGAFVGQRCQDP
NPCLSTPCKNAGTCHIVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICGCPPGFHGPTCRQDVN
ECSQNPGLCRHGGTCHNEVGSYRCTCRATHTGTHCELPYVPCSPSPCQNGGTCRPTGDTT
HECACLPGFAGQNCEENVDDCPGNNCQNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGGYNCVCVNGWTGEGCGENIDDCASAACFHGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGA
NPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMP
GYEGVYCEVNTDECASSPCLHGGHCLDKINEFLCQCPTGFSGHLCQYDVDECASTPCKNS
AKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCQPGYTGHHC
ETNINECHSQPCRHGGTCQDRDNAYLCLCLKGTTGPNCEINLDDCASSPCDSGTCLDKIN
GYECACEPGYTGSMCNVNIDECAGNPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNEC
NSNPCIHGACRDGLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCANSPCKN
SGVCKESEDYESFSCVCPTGWQGQTCEIDINECVKSPCRHGASCQNTNGGYRCLCHAGYT
GRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCRNGANC
TDCVDSYTCTCPAGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQY
NVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNDGRCWQTNTQ
YHCECRGGWTGFNCDVLSVSCEVAAQKRGIDVTLLCRHGGLCVDEDDKHHCHCQAGYTGS
YCEEEVDECSPNPCQNGATCTDYLGGYSCKCVAGYHGSNCSEEINECLSQPCQNGGTCID
LTNTYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYSCTCPPGFV
GERCEGDVNECLSNPCDPRGTQNCVQRINDFHCECRAGHTGRRCESVINGCRGKPCKNGG
VCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTG
PECQFPASSPCVGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFTGGAGRDI
PPPQIEEACELPECQEDAGNKLCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGRCDSQCNTAGCLFDGFDCQRTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVVVVLLPPEQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYY
GHEEELRKHPIKRSAAGWASPSSLLSQATSSVLPGSSGGRQRRELDPMEIRGSIVYLEID
NRQCVQSSSQCFQSATDVAAFLGALASLGSLNIPYKIEAVKSETVEPPLPPQLHLMYVAA
AAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNAS
DGALMDDQNEWGDEVLETKKFRFEESVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAPTP
PQGEVDADCMDVNVRGPDGFTPLMIASCSGGGLETANSEEEEDAPAVISDFIYQGASLHN
QTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILLR
NRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVD
AAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQ
ERMHHDIVRLLDEYNLVRSPQLHGTALGGTPTLSPTLCSPNGYLGNLKSAAQGKKARKPS
TKGPACGSKDAKDLKARRKKSQDSKGCLLDSSSMLSPVDSLESPHGYLSDVASPPLLPSP
FHQSPTMPLGHLPGMPDTHLSISHLNVAAKPEMAALGGGGRLAFEPGPPRLSHLPVASSA
STVLGASGAGAVNFTVGAPTSLNGQCEWLSRLQNGMVPNQYNPLRGSVTPGTLSTQAPGL
QHGMMGPLHSGLSTNTLSPMIYQGLPNTRLATQPHLVQTQQVQPQTLQIQPQNLQPPSQP
HLTVSSAANGHLGRSFLGGEPSQADVQPLGPSSLPVHTILPQESQALPTSLPSSLVPPMT
TAQFLTPPSQHSCSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNLSDWSEGI
SSPPTSMQSQISHIPDAFK
NT seq 7620 nt   +upstreamnt  +downstreamnt
atgccgcggctcttggcgcccctgctctgcctggccttgctgcccgcgctcgccgcgaga
ggcctgagatgctcccagccaggtgggacctgcctgaatggagggaggtgcgaagtggcc
aatggcacggaagcctgtgtgtgtagcggggccttcgttggccagcgatgccaagacccc
aacccatgcctcagcaccccctgtaagaacgcagggacatgccacatagtggaccatggt
ggcacagtggactatgcctgcagctgccccttgggcttctctgggcccctctgcctgaca
cctctggacaatgcctgtctggccaacccctgccgcaatgggggcacctgtgacctgctt
accctcaccgagtacaagtgccgctgccccccggggtggtcaggaaagtcatgccagcag
gctgacccgtgtgcctccaacccttgtgccaatggtggccagtgcctgccctttgagtcc
tcctacatctgtggatgcccacccggtttccacggccccacctgcaggcaagatgtgaac
gagtgcagtcagaaccctgggctgtgccgccacgggggcacctgccacaatgaggttggt
tcttaccgctgtacctgccgtgccacccataccggtacccactgtgagctgccctacgtg
ccctgcagcccctcaccttgtcagaatgggggcacctgccgccctacgggggacaccacc
cacgagtgtgcctgcctgccaggctttgctggccagaactgcgaggaaaatgtggacgac
tgtccagggaacaactgccagaacgggggtgcctgcgtggacggtgtgaacacctacaac
tgccgttgcccgccagagtggacaggtcagtactgcacagaggacgtggacgaatgtcag
cttatgcccaatgcctgccagaacggcggaacctgccacaacacccacggcggctacaac
tgtgtctgcgtcaacggctggacgggcgagggctgtggcgagaacattgacgattgtgcc
agtgctgcgtgtttccacggtgccacctgccatgaccgagtggcctccttctactgcgag
tgtccacatggtcgcacaggtctgctttgccacctcaatgatgcatgtatcagcaacccc
tgcaacgaaggctccaactgcgacaccaaccctgtcaacggcaaagctatctgtacctgc
ccctcgggatacacagggccagcctgcagccaggatgtggacgagtgtgctctgggtgcc
aacccctgtgagcacgcaggcaagtgcatcaacacactgggctcctttgagtgccagtgc
ctgcagggctacacgggtccccgctgtgagatcgatgttaacgagtgcatttcaaacccg
tgtcagaacgacgccacctgcctggatcagataggggagttccagtgcatctgtatgcca
ggttatgagggtgtgtactgcgaggtcaacacagatgagtgtgccagcagcccctgcctg
cacggtggccattgcctggacaagatcaatgagttcctgtgccagtgccccacaggcttc
agcgggcacctgtgtcagtatgatgtggatgagtgtgccagcacgccctgcaagaacagc
gccaagtgcctggatgggcccaacacctacacctgtgtgtgcacagaaggctacaccggg
acccactgcgaggtagacattgatgagtgtgaccctgacccctgtcactatggctcctgc
aaggatggcgtggccaccttcacctgcctctgccagccaggctacacaggccaccactgc
gagaccaacatcaatgaatgccacagccagccctgtcgccacggcggcacctgtcaggac
cgcgacaatgcctacctctgcctatgcctcaagggaaccacaggacccaactgtgagatt
aatctggatgactgtgccagtagcccctgcgactcaggcacgtgtttggacaagatcaat
ggctacgagtgtgcctgtgagccaggctacacagggagcatgtgcaatgttaacattgat
gagtgtgcaggaaatccctgccacaatgggggcacctgcgaggacggcatcgcgggcttc
acctgccgctgccccgagggctaccacgaccccacatgcctgtctgaagtcaacgaatgc
aacagcaacccttgcatccacggggcctgccgggacggtctcaatgggtataagtgtgac
tgtgaccctggttggagcggtacaaactgtgacatcaacaacaatgagtgtgagtcgaac
ccatgtgtcaatggtggcacctgcaaagacatgaccagtggttacgtgtgtacctgccga
gaaggtttcagtggccccaactgccagaccaacatcaacgagtgtgcgtccaacccatgc
ctaaaccagggcacctgtatcgatgatgtagccgggtacaagtgcaactgccctctgcct
tacacaggagccacgtgtgaggtagtgctggcgccatgtgccaacagcccctgcaaaaac
agcggggtgtgcaaggaatctgaggactacgagagtttttcctgcgtctgccctactggt
tggcaggggcaaacctgtgagatcgacatcaacgagtgtgtgaagagcccgtgtcgtcat
ggggcttcctgccagaacaccaatggtggctaccgctgcctctgccatgccggctacacg
ggccgcaactgtgagagcgacatcgatgactgtcggcccaacccgtgtcacaatggcggc
tcctgcaccgatggcatcaacacggccttctgcgactgcctgcccggcttccagggagct
ttctgtgaggaggacatcaatgagtgtgccagcaacccctgccgtaatggtgctaactgc
accgactgtgtggacagctacacgtgcacctgtccagccggcttcaacggcatacactgc
gagaacaacacaccagactgcacggagagttcctgcttcaatggcggcacctgcgtggac
ggcatcaactccttcacctgtctttgtcctcccggcttcactggcagctattgccaatac
aacgtcaacgagtgtgactcacggccatgtctgcacggcggcacctgccaggacagctac
ggcacctacaagtgcacctgcccacagggctacactggcctcaactgccagaacctcgtg
cgctggtgcgactcctctccctgcaagaatgacggcagatgctggcagaccaacactcag
taccactgtgagtgccgcggtggctggaccggcttcaactgcgacgtgctcagcgtgtcc
tgtgaggtggctgcgcaaaagcgaggcatcgacgtcaccctcctgtgccggcatggaggg
ctctgtgtggacgaggatgacaaacatcactgccactgccaggcgggctacacgggcagc
tactgtgaggaggaggtggacgagtgctcacccaacccctgccagaacggagccacctgc
actgactacctaggcggctattcctgcaagtgtgtggctggctaccatggatccaactgc
tctgaggagatcaatgagtgcctgtcccagccctgccagaacgggggcacctgcatcgac
ctgaccaacacctacaagtgctcctgcccccggggcacccagggtgtgcactgtgaaatc
aacgtggatgactgccatcccccccttgaccctgcctctcggagccccaagtgcttcaac
aatggcacctgcgtggaccaggtgggtggctacagctgcacctgcccaccgggttttgta
ggagagcggtgcgaaggtgacgtcaacgagtgtctctccaacccctgtgacccccgaggc
actcagaactgcgtgcagcgcatcaacgacttccactgcgagtgccgagctggccatacc
gggcgccgctgtgagtctgtcatcaatggctgcagaggcaaaccatgcaagaatgggggt
gtctgcgccgtggcatccaacaccgcccgaggattcatctgcaggtgccctgcgggcttc
gagggcgccacatgtgaaaacgacgcccgtacttgtggcagcctacgctgcctcaatggt
ggcacatgcatctcgggcccacgcagccccacctgcctgtgcctgggccccttcacaggc
cccgagtgccagttcccagcgagtagcccctgcgtgggtggcaacccatgctacaaccag
ggcacctgcgagcccacctccgagagccctttctaccgctgcctgtgccctgccaagttc
aacgggttgctgtgccacatcctggactacagcttcactggcggtgctgggcgtgacatc
cccccaccacagattgaagaggcctgcgagctgcccgagtgccaggaggacgcgggcaac
aagctctgcagcctgcagtgcaacaaccatgcatgtggctgggacggcggtgactgctcg
ctcaacttcaacgacccctggaagaactgtacgcagtccctgcagtgctggaaatacttc
agcgacggccgctgcgacagccagtgtaacacggctggctgcctcttcgacggcttcgac
tgccagcgcacagagggccagtgcaaccccctgtatgaccagtactgcaaggaccacttc
agcgacggccactgtgaccagggatgtaacagcgctgagtgtgagtgggacgggctggac
tgcgcagagcacgtgccagagcggctggcagccggcacgctggtggtggtggtgctgctg
ccacctgagcagctgcgcaacaactccttccacttcctgcgtgagctcagccacgtgctg
cacaccaacgtggtcttcaagcgtgatgcccaaggccaacagatgatctttccctactac
ggccatgaggaggaacttcgaaagcaccctatcaagcgctctgcagcgggctgggcctca
cccagctccctgctcagccaggccacttcttcggtgctcccaggctccagtggtgggcgc
cagcgcagggagctggaccccatggagatccgtggatccatcgtctacctggagatcgac
aaccgacagtgtgtacagtcgtcttcgcagtgtttccagagtgccaccgatgtggccgcc
ttcctgggggcacttgcctcccttggcagcctcaacatcccctacaagattgaagccgtg
aagagtgaaacggtggagccaccgctgcccccgcagctgcacctcatgtacgtggccgcc
gccgctttcgtgctgctcttctttgtgggctgcggggtgctgctgtcccgcaagcgcagg
cggcagcatggccagctctggttccctgagggcttcaaggtgtcggaagccagcaagaaa
aagcggcgagagcccctgggtgaggactctgttggcctcaagcccctgaagaatgcctca
gatggtgccctgatggacgaccagaacgaatggggagacgaagtcctggagaccaagaag
ttccggtttgaggagtcagtggttctccccgacctggatgatcagactgaccaccggcag
tggacccagcagcacctggacgccgccgacctgcgcatgtctgccatggccccaacacct
ccccagggcgaggtagacgcagactgcatggatgtcaatgtccgaggaccagatggcttc
acacccctcatgatcgcctcatgcagtggagggggcctggaaaccgccaacagtgaagag
gaagaagatgcacctgccgtcatttccgacttcatctatcaaggcgccagccttcacaac
cagacagatcgcaccggggagactgccctacacctggccgcccgctactctcgctctgat
gccgccaagcgcttgctggaggccagtgcagacgccaacatccaggacaacatgggtcgc
accccgctgcatgcagctgtttctgccgatgctcagggtgtcttccagatcttgcttcgg
aaccgagccacagacctggatgcccgcatgcatgacggcacgacaccactaatcttggct
gcgcgcttggctgtggagggcatgctggaggacctcatcaactcacatgctgacgtcaat
gccgtggatgatctaggcaaatcagccttgcactgggcagcggctgtgaacaacgtggac
gctgcggtggttctcttgaagaacggagccaacaaggacatgcagaacaacaaggaagag
actcctctgttcctggccgcccgtgagggaagctacgagactgccaaggtgctgctggac
cactttgccaaccgggacatcacggaccacatggaccgcctgccgagggacatcgcgcag
gaacgcatgcaccatgatatcgtgcgcctgctggacgagtacaacctggtgcgcagtccc
cagctgcatggcaccgccctgggcggcacacccaccttgtctcccactctctgctcgccc
aatggctacctgggcaacctcaagtctgctgcacagggcaagaaggcccgcaagcccagc
accaaagggccggcctgcggcagcaaggacgctaaagacctcaaggcccggaggaagaag
tcccaggacagcaaaggctgcctgttggacagttcgagcatgctgtcaccagtagactct
ctcgagtcaccccacggctatctgtcagacgtggcctcaccgcccctcctgccctcccca
ttccatcagtccccaaccatgcctcttggccacctgcctggcatgcccgacacccacctg
agcatcagccatctgaatgtggctgccaaaccagagatggcagcattgggtgggggcggc
cggctggcttttgagcctggccccccgcgcctctcccacttgcctgtagcctctagtgcc
agcacggtgctgggcgccagtggagcaggggctgtgaattttaccgtgggtgcgcctacc
agcttgaatggccagtgcgagtggctttcccggctgcagaacggcatggtcccgaaccag
tacaaccctctgcggggaagcgtgacaccgggcacgctgagcacacaggcacctggcctc
cagcatggtatgatgggtccgctgcacagcggcctctctaccaataccctgtccccgatg
atctaccagggcctgcccaacacacggctggccacccagccacacctggtgcagacccag
caggtgcaaccacagactttgcaaatacagcctcagaacctgcagccaccatcgcagcca
cacctcaccgtgagctccgcagctaatgggcacctgggccggagcttcctgggtggggag
cccagccaagcggacgtgcagcccctgggccccagcagcctgcctgtgcacaccatcttg
ccccaggagagccaggccctgcccacatcactgccatcctcgctggtcccacccatgacc
actgcccagttcctgaccccaccatcccagcacagctgttcctcttcacctgtggacaac
acccccagccaccagctgcaggtgcccgagcaccccttccttaccccatctccagagtcc
ccggatcagtggtccagctcctccccacattccaacctctctgattggtccgagggcatc
tccagcccgcccaccagcatgcagtcccagatttcacacattcctgatgccttcaagtaa

DBGET integrated database retrieval system