KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724413
Entry
103724413         CDS       T03372                                 

Gene name
Atf6b
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04141  Protein processing in endoplasmic reticulum
ngi04151  PI3K-Akt signaling pathway
ngi04211  Longevity regulating pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04668  TNF signaling pathway
ngi04728  Dopaminergic synapse
ngi04911  Insulin secretion
ngi04915  Estrogen signaling pathway
ngi04918  Thyroid hormone synthesis
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi05020  Prion disease
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05034  Alcoholism
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103724413 (Atf6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103724413 (Atf6b)
   04022 cGMP-PKG signaling pathway
    103724413 (Atf6b)
   04151 PI3K-Akt signaling pathway
    103724413 (Atf6b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103724413 (Atf6b)
   04915 Estrogen signaling pathway
    103724413 (Atf6b)
   04926 Relaxin signaling pathway
    103724413 (Atf6b)
   04935 Growth hormone synthesis, secretion and action
    103724413 (Atf6b)
   04918 Thyroid hormone synthesis
    103724413 (Atf6b)
   04928 Parathyroid hormone synthesis, secretion and action
    103724413 (Atf6b)
   04925 Aldosterone synthesis and secretion
    103724413 (Atf6b)
   04927 Cortisol synthesis and secretion
    103724413 (Atf6b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103724413 (Atf6b)
  09156 Nervous system
   04728 Dopaminergic synapse
    103724413 (Atf6b)
  09149 Aging
   04211 Longevity regulating pathway
    103724413 (Atf6b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103724413 (Atf6b)
  09164 Neurodegenerative disease
   05020 Prion disease
    103724413 (Atf6b)
  09165 Substance dependence
   05030 Cocaine addiction
    103724413 (Atf6b)
   05031 Amphetamine addiction
    103724413 (Atf6b)
   05034 Alcoholism
    103724413 (Atf6b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103724413 (Atf6b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103724413 (Atf6b)
   05161 Hepatitis B
    103724413 (Atf6b)
   05163 Human cytomegalovirus infection
    103724413 (Atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103724413 (Atf6b)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103724413 (Atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB GIT_CC YabA DUF4407
Other DBs
NCBI-GeneID: 103724413
NCBI-ProteinID: XP_008819698
LinkDB
Position
Un
AA seq 699 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYAGLDEVSEEQTQLFRSVEQDVPFDSALD
LGMDVSPPEPPWDSLPIFPDLQVKSEPSSPCSSSSLSSESSQLSTEPSSQACIVGEVLHV
KTESLAPPLCLLGDDPVSPFETVQITVGSASDDASDIQTKVEPASPSSSVNSEASLLPAD
SPSQAFVGEEVLEVKTESPSPPGCLLWDVPAPSLGAVQISMGPSPDSSSGKAPPATRKPT
LQPKPVVLTAVQMPPRAGPPSTTVLLPLVQQPAVSPVVLIQGAIRVQPEGPTPAVPRPER
KSIVPAPMPGNSGPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQVVLADN
QQLRRENIALRRRLEALLAENSELKLGSGNRKALCIVVFLLFIAFNFGPVSISEPPPTPI
SPRMNREEPQLQRHLLEFSEQEPVGGVEPLQGAAQSPEEPQPSPAGWPSFRNLTTFPGGA
KELLLRDLDQLFLSSDCRHFNKTESLRLADELSGWVQRHQRGRRKTPQRAQERQKPQLRK
KSPPVRPVPTQPPGPPERDSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVVSFRRDHLLL
PAISHNKTSRPKMSLVMPAMAPNETVSGRGASGDYEEMMQIECEVMDTRVIHIKTSTVPP
SLRKQPSPTPGNTTGGPLPVSAASQAHQASHQPLYLSHP
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctccttagcgagatcgccgacccgacgcgcttcttcaccgacaac
ctactgagcccggaggactgggacagcaccttgtatgccggcctggatgaagtgtccgag
gagcagacgcagctgttccgcagcgtggagcaggatgtcccgtttgacagcgcactggat
ttggggatggacgtcagcccccctgagcccccatgggactccctgcctatcttcccagat
cttcaggtgaagtctgagccgtcctctccctgctcttcctcctccctcagctcagaatca
tcacagctttctaccgagccttccagccaggcctgtatagtaggggaggttctgcatgtg
aagaccgagtccttagcacccccactctgcctgctgggagatgatccagtatccccattt
gaaacagtgcagatcaccgtgggctctgcctctgatgatgcgtcagatatccagaccaag
gtagaacctgcctcaccatcgtcttctgtcaactccgaggcctccttgctcccagccgac
tccccaagccaggcttttgtaggagaggaggtcctggaggtgaagacagaatccccgtcc
cctccaggatgcctcctgtgggatgttccagccccctcacttggagctgtccagatcagc
atgggtccatcccctgatagttcctcaggcaaagctcctccagccacacggaagcccaca
ctgcagcccaaacccgtggtgctaaccgctgtccagatgccacccagagccgggcctccc
agcaccactgtccttttgccccttgtccagcagcctgcagtgtccccagtagtcctcatc
caaggtgctatccgagtccaacctgaagggcccactccagctgttccccgacccgagagg
aagagcatcgtgccggctcctatgcctgggaactcaggcccacctgaagtggatgcaaag
ctgctgaagcgtcaacagcgaatgatcaagaacagagagtcagcctgccagtcccggcgg
aagaagaaggagtatctgcaggggctggaggccaggttgcaggtggtgctggccgacaac
cagcagctgcggagggaaaacattgccctccggcggcggctggaggccctgttggccgag
aacagcgaactcaagttggggtccgggaacaggaaggcgctgtgcatcgtggtcttcctt
ctcttcatcgccttcaactttggacctgtcagcatcagtgaaccacctccaactcccatc
tctcctcggatgaacagagaggagcctcaactccagagacacctgctggagttctcagag
caagagccggttggcggagttgagcccctccagggagctgcccagagccctgaggagcca
cagcccagccctgcaggctggcctagtttcaggaacctgacgaccttccccggcggggcc
aaggagctactcctgagagacctagaccagctcttcctctcctccgactgccggcacttc
aacaaaactgagtccctgaggcttgctgacgagctgagtggctgggtccagcgccaccag
agaggccgacggaagacgcctcagcgggcccaggagagacagaagccacagctacggaag
aagtcaccgccggtgaggccggtccccactcagcccccaggacctcctgaacgagattct
gtgggccaactgcagctctatcgccacccagaccggtcacagccagagttcctggatgca
attgatcgtcgggaagacacgttttatgttgtctccttccgaagggaccacctgctgctc
ccagccatcagccacaacaagacatcccggcctaagatgtccctggtgatgccagccatg
gcccccaatgagactgtgtcaggccggggggcctcaggggactatgaggagatgatgcag
atcgagtgtgaggtcatggacaccagggtgattcacatcaagacctccaccgtgcccccc
tcgctccgaaagcagccatccccaaccccgggcaataccacaggtggccccttgccagtt
tccgcagccagtcaggcccatcaggcctcccaccagcccctctacctcagccatccctga

DBGET integrated database retrieval system