KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724413
Entry
103724413         CDS       T03372                                 

Gene name
Atf6b
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04141  Protein processing in endoplasmic reticulum
ngi04151  PI3K-Akt signaling pathway
ngi04211  Longevity regulating pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04668  TNF signaling pathway
ngi04728  Dopaminergic synapse
ngi04911  Insulin secretion
ngi04915  Estrogen signaling pathway
ngi04918  Thyroid hormone synthesis
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi05020  Prion disease
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05034  Alcoholism
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103724413 (Atf6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103724413 (Atf6b)
   04022 cGMP-PKG signaling pathway
    103724413 (Atf6b)
   04151 PI3K-Akt signaling pathway
    103724413 (Atf6b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103724413 (Atf6b)
   04915 Estrogen signaling pathway
    103724413 (Atf6b)
   04926 Relaxin signaling pathway
    103724413 (Atf6b)
   04935 Growth hormone synthesis, secretion and action
    103724413 (Atf6b)
   04918 Thyroid hormone synthesis
    103724413 (Atf6b)
   04928 Parathyroid hormone synthesis, secretion and action
    103724413 (Atf6b)
   04925 Aldosterone synthesis and secretion
    103724413 (Atf6b)
   04927 Cortisol synthesis and secretion
    103724413 (Atf6b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103724413 (Atf6b)
  09156 Nervous system
   04728 Dopaminergic synapse
    103724413 (Atf6b)
  09149 Aging
   04211 Longevity regulating pathway
    103724413 (Atf6b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103724413 (Atf6b)
  09164 Neurodegenerative disease
   05020 Prion disease
    103724413 (Atf6b)
  09165 Substance dependence
   05030 Cocaine addiction
    103724413 (Atf6b)
   05031 Amphetamine addiction
    103724413 (Atf6b)
   05034 Alcoholism
    103724413 (Atf6b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103724413 (Atf6b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103724413 (Atf6b)
   05161 Hepatitis B
    103724413 (Atf6b)
   05163 Human cytomegalovirus infection
    103724413 (Atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103724413 (Atf6b)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103724413 (Atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB GIT_CC YabA DUF4407
Other DBs
NCBI-GeneID: 103724413
NCBI-ProteinID: XP_008819698
LinkDB
Position
Un
AA seq 699 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYAGLDEVSEEQTQLFRSVEQDVPFDSALD
LGMDVSPPEPPWDSLPIFPDLQVKSEPSSPCSSSSLSSESSQLSTEPSSQACIVGEVLHV
KTESLAPPLCLLGDDPVSPFETVQITVGSASDDASDIQTKVEPASPSSSVNSEASLLPAD
SPSQAFVGEEVLEVKTESPSPPGCLLWDVPAPSLGAVQISMGPSPDSSSGKAPPATRKPT
LQPKPVVLTAVQMPPRAGPPSTTVLLPLVQQPAVSPVVLIQGAIRVQPEGPTPAVPRPER
KSIVPAPMPGNSGPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQVVLADN
QQLRRENIALRRRLEALLAENSELKLGSGNRKALCIVVFLLFIAFNFGPVSISEPPPTPI
SPRMNREEPQLQRHLLEFSEQEPVGGVEPLQGAAQSPEEPQPSPAGWPSFRNLTTFPGGA
KELLLRDLDQLFLSSDCRHFNKTESLRLADELSGWVQRHQRGRRKTPQRAQERQKPQLRK
KSPPVRPVPTQPPGPPERDSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVVSFRRDHLLL
PAISHNKTSRPKMSLVMPAMAPNETVSGRGASGDYEEMMQIECEVMDTRVIHIKTSTVPP
SLRKQPSPTPGNTTGGPLPVSAASQAHQASHQPLYLSHP
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctccttagcgagatcgccgacccgacgcgcttcttcaccgacaac
ctactgagcccggaggactgggacagcaccttgtatgccggcctggatgaagtgtccgag
gagcagacgcagctgttccgcagcgtggagcaggatgtcccgtttgacagcgcactggat
ttggggatggacgtcagcccccctgagcccccatgggactccctgcctatcttcccagat
cttcaggtgaagtctgagccgtcctctccctgctcttcctcctccctcagctcagaatca
tcacagctttctaccgagccttccagccaggcctgtatagtaggggaggttctgcatgtg
aagaccgagtccttagcacccccactctgcctgctgggagatgatccagtatccccattt
gaaacagtgcagatcaccgtgggctctgcctctgatgatgcgtcagatatccagaccaag
gtagaacctgcctcaccatcgtcttctgtcaactccgaggcctccttgctcccagccgac
tccccaagccaggcttttgtaggagaggaggtcctggaggtgaagacagaatccccgtcc
cctccaggatgcctcctgtgggatgttccagccccctcacttggagctgtccagatcagc
atgggtccatcccctgatagttcctcaggcaaagctcctccagccacacggaagcccaca
ctgcagcccaaacccgtggtgctaaccgctgtccagatgccacccagagccgggcctccc
agcaccactgtccttttgccccttgtccagcagcctgcagtgtccccagtagtcctcatc
caaggtgctatccgagtccaacctgaagggcccactccagctgttccccgacccgagagg
aagagcatcgtgccggctcctatgcctgggaactcaggcccacctgaagtggatgcaaag
ctgctgaagcgtcaacagcgaatgatcaagaacagagagtcagcctgccagtcccggcgg
aagaagaaggagtatctgcaggggctggaggccaggttgcaggtggtgctggccgacaac
cagcagctgcggagggaaaacattgccctccggcggcggctggaggccctgttggccgag
aacagcgaactcaagttggggtccgggaacaggaaggcgctgtgcatcgtggtcttcctt
ctcttcatcgccttcaactttggacctgtcagcatcagtgaaccacctccaactcccatc
tctcctcggatgaacagagaggagcctcaactccagagacacctgctggagttctcagag
caagagccggttggcggagttgagcccctccagggagctgcccagagccctgaggagcca
cagcccagccctgcaggctggcctagtttcaggaacctgacgaccttccccggcggggcc
aaggagctactcctgagagacctagaccagctcttcctctcctccgactgccggcacttc
aacaaaactgagtccctgaggcttgctgacgagctgagtggctgggtccagcgccaccag
agaggccgacggaagacgcctcagcgggcccaggagagacagaagccacagctacggaag
aagtcaccgccggtgaggccggtccccactcagcccccaggacctcctgaacgagattct
gtgggccaactgcagctctatcgccacccagaccggtcacagccagagttcctggatgca
attgatcgtcgggaagacacgttttatgttgtctccttccgaagggaccacctgctgctc
ccagccatcagccacaacaagacatcccggcctaagatgtccctggtgatgccagccatg
gcccccaatgagactgtgtcaggccggggggcctcaggggactatgaggagatgatgcag
atcgagtgtgaggtcatggacaccagggtgattcacatcaagacctccaccgtgcccccc
tcgctccgaaagcagccatccccaaccccgggcaataccacaggtggccccttgccagtt
tccgcagccagtcaggcccatcaggcctcccaccagcccctctacctcagccatccctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726130
Entry
103726130         CDS       T03372                                 

Gene name
Creb3l2
Definition
(RefSeq) cAMP responsive element binding protein 3 like 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04668  TNF signaling pathway
ngi04714  Thermogenesis
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04911  Insulin secretion
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04922  Glucagon signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04931  Insulin resistance
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04962  Vasopressin-regulated water reabsorption
ngi05016  Huntington disease
ngi05020  Prion disease
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05034  Alcoholism
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05203  Viral carcinogenesis
ngi05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103726130 (Creb3l2)
   04024 cAMP signaling pathway
    103726130 (Creb3l2)
   04022 cGMP-PKG signaling pathway
    103726130 (Creb3l2)
   04151 PI3K-Akt signaling pathway
    103726130 (Creb3l2)
   04152 AMPK signaling pathway
    103726130 (Creb3l2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103726130 (Creb3l2)
   04922 Glucagon signaling pathway
    103726130 (Creb3l2)
   04915 Estrogen signaling pathway
    103726130 (Creb3l2)
   04926 Relaxin signaling pathway
    103726130 (Creb3l2)
   04935 Growth hormone synthesis, secretion and action
    103726130 (Creb3l2)
   04918 Thyroid hormone synthesis
    103726130 (Creb3l2)
   04928 Parathyroid hormone synthesis, secretion and action
    103726130 (Creb3l2)
   04916 Melanogenesis
    103726130 (Creb3l2)
   04925 Aldosterone synthesis and secretion
    103726130 (Creb3l2)
   04927 Cortisol synthesis and secretion
    103726130 (Creb3l2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103726130 (Creb3l2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103726130 (Creb3l2)
  09156 Nervous system
   04725 Cholinergic synapse
    103726130 (Creb3l2)
   04728 Dopaminergic synapse
    103726130 (Creb3l2)
  09149 Aging
   04211 Longevity regulating pathway
    103726130 (Creb3l2)
  09159 Environmental adaptation
   04714 Thermogenesis
    103726130 (Creb3l2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103726130 (Creb3l2)
  09162 Cancer: specific types
   05215 Prostate cancer
    103726130 (Creb3l2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103726130 (Creb3l2)
   05020 Prion disease
    103726130 (Creb3l2)
  09165 Substance dependence
   05030 Cocaine addiction
    103726130 (Creb3l2)
   05031 Amphetamine addiction
    103726130 (Creb3l2)
   05034 Alcoholism
    103726130 (Creb3l2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103726130 (Creb3l2)
   04934 Cushing syndrome
    103726130 (Creb3l2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103726130 (Creb3l2)
   05161 Hepatitis B
    103726130 (Creb3l2)
   05163 Human cytomegalovirus infection
    103726130 (Creb3l2)
   05165 Human papillomavirus infection
    103726130 (Creb3l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103726130 (Creb3l2)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103726130 (Creb3l2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HAUS6_N JMY
Other DBs
NCBI-GeneID: 103726130
NCBI-ProteinID: XP_017651184
LinkDB
Position
Un
AA seq 520 aa
MEVLESGEQSVLQWDRKLSELSEPGDTEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
NVSMEVEPSPTSPAPLIQAEHSYSLCEEPRDQSPFTHVATGDSFNDEEVESEKWYLSADF
PPATIKTEPITEEPPPGLVPSVTLTITAISTPFEKEEAPVDVNAGVDSSCQTSIPKIKLE
PHEVDQFLNFSPKEASMDHLHLPPTPPSSHSSDSEGSLSPNPRLHPFSLSQAHSPARAMP
RAPSALSTSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLSESYT
ASVVRSRNLLIYEEHSPLEESSSPASAAELGGWDRGSSLLRASGLEPLPEVDLPHFIISN
ETNLEKSVLFELQQHLVNSKLEGNETLKVVELDRRVNTTF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggacaccgaggccctcatgtaccacacgcatttctcagaacttctg
gatgagttttcccagaatgtcttgggacagctcctgaatgatcctttcctctcagagaag
aatgtgtccatggaggtggaaccatccccaacatcaccagcgcctctcatccaggctgaa
cacagctactccctgtgtgaggagcctcgggaccagtcaccattcacccatgtggctacc
ggcgacagcttcaatgatgaggaggtggaaagtgagaaatggtatctgtctgcggacttt
cctccagccaccatcaagacagagccgattacagaggagccacccccaggacttgttcct
tctgtcactctgaccatcactgccatttccactccttttgaaaaagaagaagcccctgtg
gatgtgaatgctggggtggattcctcatgccagacaagtattcctaagatcaagctggag
cctcatgaagtggatcagtttctaaacttctctcctaaagaagcctccatggaccacctg
cacctaccgccaacccctcccagcagtcacagcagtgactcagagggcagcctgagcccc
aacccgcgcctgcatcccttcagtctgtctcaggcccacagtcccgccagagccatgccc
cgggccccctcagccctgtccacatctcctctcctcacggctccacataagctgcaggga
tctggcccactggtcctgacagaggaggagaagaggactctgattgctgagggctatcct
atccccaccaaactgcccctcacgaaatctgaggaaaaggccctgaagaaaatacgaagg
aaaatcaagaacaagatttctgcccaggaaagcaggagaaagaagaaggaatacatggac
agcttggagaaaaaagtggagtcttgctcaactgagaacttggaacttcggaagaaggta
gaggtgctggagaacaccaacaggactctgcttcagcaactccagaaacttcagactttg
gtcatgggaaaggtttctcgaacctgcaagttagccggcacacagacgggcacctgcctc
atggtcgttgtgctgtgctttgctgtcgcatttggcagcttctttcagggctatgggcct
tatccttctgccaccaagatggccctgcccagccaacattccctgtcagagtcatacaca
gcctccgtggtgagatccaggaacctgctcatctatgaggaacattctcccctggaggag
tcgtctagtccagcctcagctgcagagcttggaggctgggacagaggctcctcactgctc
agggcatcagggctagagcccctgccggaagtggatcttcctcatttcattatctccaat
gagaccaacttggagaagtcagtgctgtttgagctacagcagcatctggtcaacagcaaa
ctggaagggaatgaaacactcaaagttgtagaactcgacagaagagtgaacaccaccttc
taa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737277
Entry
103737277         CDS       T03372                                 

Gene name
Creb3l3
Definition
(RefSeq) cAMP responsive element binding protein 3 like 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04668  TNF signaling pathway
ngi04714  Thermogenesis
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04911  Insulin secretion
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04922  Glucagon signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04931  Insulin resistance
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04962  Vasopressin-regulated water reabsorption
ngi05016  Huntington disease
ngi05020  Prion disease
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05034  Alcoholism
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05203  Viral carcinogenesis
ngi05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103737277 (Creb3l3)
   04024 cAMP signaling pathway
    103737277 (Creb3l3)
   04022 cGMP-PKG signaling pathway
    103737277 (Creb3l3)
   04151 PI3K-Akt signaling pathway
    103737277 (Creb3l3)
   04152 AMPK signaling pathway
    103737277 (Creb3l3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103737277 (Creb3l3)
   04922 Glucagon signaling pathway
    103737277 (Creb3l3)
   04915 Estrogen signaling pathway
    103737277 (Creb3l3)
   04926 Relaxin signaling pathway
    103737277 (Creb3l3)
   04935 Growth hormone synthesis, secretion and action
    103737277 (Creb3l3)
   04918 Thyroid hormone synthesis
    103737277 (Creb3l3)
   04928 Parathyroid hormone synthesis, secretion and action
    103737277 (Creb3l3)
   04916 Melanogenesis
    103737277 (Creb3l3)
   04925 Aldosterone synthesis and secretion
    103737277 (Creb3l3)
   04927 Cortisol synthesis and secretion
    103737277 (Creb3l3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103737277 (Creb3l3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103737277 (Creb3l3)
  09156 Nervous system
   04725 Cholinergic synapse
    103737277 (Creb3l3)
   04728 Dopaminergic synapse
    103737277 (Creb3l3)
  09149 Aging
   04211 Longevity regulating pathway
    103737277 (Creb3l3)
  09159 Environmental adaptation
   04714 Thermogenesis
    103737277 (Creb3l3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103737277 (Creb3l3)
  09162 Cancer: specific types
   05215 Prostate cancer
    103737277 (Creb3l3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103737277 (Creb3l3)
   05020 Prion disease
    103737277 (Creb3l3)
  09165 Substance dependence
   05030 Cocaine addiction
    103737277 (Creb3l3)
   05031 Amphetamine addiction
    103737277 (Creb3l3)
   05034 Alcoholism
    103737277 (Creb3l3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103737277 (Creb3l3)
   04934 Cushing syndrome
    103737277 (Creb3l3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103737277 (Creb3l3)
   05161 Hepatitis B
    103737277 (Creb3l3)
   05163 Human cytomegalovirus infection
    103737277 (Creb3l3)
   05165 Human papillomavirus infection
    103737277 (Creb3l3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103737277 (Creb3l3)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103737277 (Creb3l3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 103737277
NCBI-ProteinID: XP_008835303
LinkDB
Position
Un
AA seq 458 aa
MDGNLTAEKMASPTCAMGSLDSLELLDLLFDRQDGILRHIEVGEDWSLTTEEQVLPNSDS
DDFLNSILGQGDSDPTSPIWSPAASDSGISEDLPSDAQDIPPRSSGGTVDTTTRCHLAEP
GKGLCPSYVPRTPCPVAPQAPVLESSVAIDLDPWTGEGLYAEEQSSSLSRFSLSVKDLLL
SSSGGDLQQHHPAASHLLGPGNGHCQELVLTEDEKKLLAKEGVALPTQLPLTKYEERVLK
KIRRKIRNKQSAQESRKKKKEYIDGLEIRMSACTAQNQELQRKVLHLEKQNLSLLEQLKK
LQALVVQSTSKSAQTGTCIAVLLLSFVLIILPSVSPFASNKADNPGDFAPMRVFSRTLHN
YAASRVARDTVPGSEVPGPWPDVSTPHKGSPPSSLSTDWGNFLEIPVLGNSTDELDNSTL
VLVNSTEDLGQATLLDWVASEQLLSPGRGGLDTAGEEL
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggatgggaacttaacagctgagaagatggcttcccccacctgcgcaatgggttccctg
gacagcctggagcttctagaccttctattcgacaggcaggatggcatcctgcgacacata
gaggtgggggaggactggagcctcaccacggaggagcaggttctaccaaattctgactct
gatgacttcctaaattccatcctgggacagggagactctgaccccacttcccccatctgg
tctccggctgccagtgacagtggcatttctgaagatctgccctctgatgcccaggacatc
cctcctcgcagcagtggggggacagtggatacgacaaccaggtgtcatctggccgagcct
ggcaaagggctctgtccatcctatgtccccaggaccccatgccctgtggctccccaggca
ccagttcttgagtcctctgtggccatcgacctggacccgtggactggggagggcctatat
gcagaggagcagtcgagctcactgtcccgcttcagcctctccgtgaaggatcttctgcta
tcgagcagcggcggggacttgcaacagcatcacccggctgcctcccacctgctgggacct
gggaatggacactgtcaggagctggtattgactgaagatgagaagaaacttctggctaag
gaaggtgtcgcgcttcccacacagctgccccttaccaagtatgaggagagggtgctgaaa
aaaatccgcagaaagatccggaacaaacaatcagctcaagaaagcaggaagaagaagaag
gagtacatcgatggcctagagatacggatgtcagcctgcaccgcccagaaccaggagctg
cagaggaaagttctacacttggaaaagcaaaacctgtctcttctcgaacaactgaagaaa
cttcaggcccttgtggtccagtccaccagcaagtcagcccagacgggcacttgtatagcg
gtccttttgctgtcctttgtcctcatcatcctcccttctgtcagccccttcgcctccaac
aaagccgacaatcccggagattttgcgcccatgcgagtgttttccagaaccctgcacaac
tacgctgcatcccgcgtggctcgagacactgtcccaggctccgaggtcccaggaccctgg
cccgacgtcagcacaccccacaaaggttctcctcccagcagcctcagtacagactggggg
aactttctagaaataccagtgctgggtaattcaacagatgaactcgacaactccaccctg
gtgttggtcaactccacggaggacctgggccaggccaccctgctggactgggtggcctca
gaacagctgcttagcccaggacgtggggggctggacacagctggagaggagctgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740829
Entry
103740829         CDS       T03372                                 

Gene name
Creb5
Definition
(RefSeq) cAMP responsive element binding protein 5
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04668  TNF signaling pathway
ngi04714  Thermogenesis
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04911  Insulin secretion
ngi04915  Estrogen signaling pathway
ngi04918  Thyroid hormone synthesis
ngi04922  Glucagon signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04931  Insulin resistance
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04962  Vasopressin-regulated water reabsorption
ngi05016  Huntington disease
ngi05020  Prion disease
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05034  Alcoholism
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05203  Viral carcinogenesis
ngi05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103740829 (Creb5)
   04024 cAMP signaling pathway
    103740829 (Creb5)
   04022 cGMP-PKG signaling pathway
    103740829 (Creb5)
   04151 PI3K-Akt signaling pathway
    103740829 (Creb5)
   04152 AMPK signaling pathway
    103740829 (Creb5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103740829 (Creb5)
   04922 Glucagon signaling pathway
    103740829 (Creb5)
   04915 Estrogen signaling pathway
    103740829 (Creb5)
   04926 Relaxin signaling pathway
    103740829 (Creb5)
   04935 Growth hormone synthesis, secretion and action
    103740829 (Creb5)
   04918 Thyroid hormone synthesis
    103740829 (Creb5)
   04928 Parathyroid hormone synthesis, secretion and action
    103740829 (Creb5)
   04925 Aldosterone synthesis and secretion
    103740829 (Creb5)
   04927 Cortisol synthesis and secretion
    103740829 (Creb5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103740829 (Creb5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103740829 (Creb5)
  09156 Nervous system
   04725 Cholinergic synapse
    103740829 (Creb5)
   04728 Dopaminergic synapse
    103740829 (Creb5)
  09149 Aging
   04211 Longevity regulating pathway
    103740829 (Creb5)
  09159 Environmental adaptation
   04714 Thermogenesis
    103740829 (Creb5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103740829 (Creb5)
  09162 Cancer: specific types
   05215 Prostate cancer
    103740829 (Creb5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103740829 (Creb5)
   05020 Prion disease
    103740829 (Creb5)
  09165 Substance dependence
   05030 Cocaine addiction
    103740829 (Creb5)
   05031 Amphetamine addiction
    103740829 (Creb5)
   05034 Alcoholism
    103740829 (Creb5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103740829 (Creb5)
   04934 Cushing syndrome
    103740829 (Creb5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103740829 (Creb5)
   05161 Hepatitis B
    103740829 (Creb5)
   05163 Human cytomegalovirus infection
    103740829 (Creb5)
   05165 Human papillomavirus infection
    103740829 (Creb5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103740829 (Creb5)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    103740829 (Creb5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri Cnn_1N NDUFB11 DivIC
Other DBs
NCBI-GeneID: 103740829
NCBI-ProteinID: XP_008839743
LinkDB
Position
Un
AA seq 501 aa
MNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLK
NCEEVGLFSELDCSFEHEFRKVQEEENSKRNISMHNTVGGAMTGPGAHQLGSTRMPNHDT
SVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPT
MPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAM
SNGNMSTIGHMMEMMGSRQDQTSHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHH
QQSHPHHHSHSHLHTHPAHHQTSPHPPLHSGNQAQVSPATQQMQPTQTIQPPQPTGGRRR
RVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNE
VAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSE
VVGSSTLSQLTTHRTDLNPIL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaacttggagcaggagaggccgtttgtctgcagtgccccaggctgctcccagcgtttc
ccaacagaggaccacctgatgattcataggcacaagcatgagatgactctgaagtttccc
tcaataaaaacagacaacatgttatcagatcagactccaacccctacgagattcctgaag
aactgtgaggaggtgggtctcttcagtgagctggactgctccttcgagcatgaattcagg
aaggttcaggaggaggagaacagcaagcggaatatctccatgcataatacagttggtggg
gctatgacagggcctggagctcaccagctgggcagcactcgaatgcccaaccacgacacc
agtgttgtgattcagcaagccatgccttcgccccagtccagctcagtcatcacacaggct
ccttccaccaaccgccagatcgggcctgtcccaggctctctatcgtctctgcttcatctc
cacaacagacagaggcagcccatgccagcctccatgcctgggaccctgcctaaccccacc
atgccaggatcttctgcagtcttgatgccaatggagagacaaatgtcagtgaactccagc
atcatgggcatgcaaggtccaaacctcagcaacccctgtgcttctccccaagtccagcca
atgcattccgaagccaaaatgaggttgaaggccgcattgactcaccaccctgctgctatg
tcaaatggaaacatgagcaccataggacacatgatggagatgatgggctcccggcaagac
cagacgtcgcaccaccacatgcactcacacccgcatcagcaccagacactgccacctcac
cacccctacccacaccagcaccagcacccagcacaccacccccacccgcagccccatcac
cagcagagccacccacatcatcactcccattcccaccttcacacacacccagcacaccac
cagacctcgccacacccgcccctgcacagtggcaaccaagcacaggtttcaccagccaca
caacagatgcaaccaacccagacaatacagccgccacagcccacaggaggacgtcggcga
agggtggtggatgaggatccagatgagaggcggaggaaatttctggaacggaacagggca
gctgccacccgctgcagacagaagaggaaggtctgggtgatgtcactggaaaagaaagca
gaagagctcacccagacaaacatgcagcttcagaatgaagtatccatgttgaaaaacgaa
gtggcccagctgaaacagttgttgttaacacataaagactgcccaataacagccatgcag
aaagaatcacaaggatatttaagtccagagagtagtcctcctgcaagtcctgtcccagca
tgctcacagcagcaggttatccagcataacaccatcactacgtcctcatcagtcagcgag
gttgtggggagctccaccctcagccagctcactactcacagaacagatctgaatcctatt
ctttaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741536
Entry
103741536         CDS       T03372                                 

Gene name
Creb3
Definition
(RefSeq) cAMP responsive element binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04668  TNF signaling pathway
ngi04714  Thermogenesis
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04911  Insulin secretion
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04922  Glucagon signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04931  Insulin resistance
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04962  Vasopressin-regulated water reabsorption
ngi05016  Huntington disease
ngi05020  Prion disease
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05034  Alcoholism
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05203  Viral carcinogenesis
ngi05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103741536 (Creb3)
   04024 cAMP signaling pathway
    103741536 (Creb3)
   04022 cGMP-PKG signaling pathway
    103741536 (Creb3)
   04151 PI3K-Akt signaling pathway
    103741536 (Creb3)
   04152 AMPK signaling pathway
    103741536 (Creb3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103741536 (Creb3)
   04922 Glucagon signaling pathway
    103741536 (Creb3)
   04915 Estrogen signaling pathway
    103741536 (Creb3)
   04926 Relaxin signaling pathway
    103741536 (Creb3)
   04935 Growth hormone synthesis, secretion and action
    103741536 (Creb3)
   04918 Thyroid hormone synthesis
    103741536 (Creb3)
   04928 Parathyroid hormone synthesis, secretion and action
    103741536 (Creb3)
   04916 Melanogenesis
    103741536 (Creb3)
   04925 Aldosterone synthesis and secretion
    103741536 (Creb3)
   04927 Cortisol synthesis and secretion
    103741536 (Creb3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103741536 (Creb3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103741536 (Creb3)
  09156 Nervous system
   04725 Cholinergic synapse
    103741536 (Creb3)
   04728 Dopaminergic synapse
    103741536 (Creb3)
  09149 Aging
   04211 Longevity regulating pathway
    103741536 (Creb3)
  09159 Environmental adaptation
   04714 Thermogenesis
    103741536 (Creb3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103741536 (Creb3)
  09162 Cancer: specific types
   05215 Prostate cancer
    103741536 (Creb3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103741536 (Creb3)
   05020 Prion disease
    103741536 (Creb3)
  09165 Substance dependence
   05030 Cocaine addiction
    103741536 (Creb3)
   05031 Amphetamine addiction
    103741536 (Creb3)
   05034 Alcoholism
    103741536 (Creb3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103741536 (Creb3)
   04934 Cushing syndrome
    103741536 (Creb3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103741536 (Creb3)
   05161 Hepatitis B
    103741536 (Creb3)
   05163 Human cytomegalovirus infection
    103741536 (Creb3)
   05165 Human papillomavirus infection
    103741536 (Creb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103741536 (Creb3)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103741536 (Creb3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB
Other DBs
NCBI-GeneID: 103741536
NCBI-ProteinID: XP_008840589
LinkDB
Position
Un
AA seq 409 aa
MSQMELALDPGDQDLLGFLLEESGDLWPEPDRYAEAPLDWELRSSENSVQALSDWEVEDL
LSSLLSPSASPDVLDSSNSSVHHDHTYSLPQEHVSIDLDSGSCEKEGSCLTPLLVEEAAE
QVLEFSGLSPPCTTGDKSSHFSLTTQCKSAVHHSQEISRLNLTEEEKRLLEKEGFTLPSM
RPLTKMEEQVLKRVRRKIRNKRSAQESRKKKKVYVGGLESRVLKYTAQNQELQNKVQLLE
EQNLSLLDQLRRLQAMVIEIANKSSSGSTCVLVLLFSFCLLLVPAMYSSDTRGNMPAEYV
ALHRQLRTLRSEDPQQLKLPALQSEVPRDSTGQLLDSSEHTLQASSNFSCLLYHMPQAEP
PLQQPLPDLSQETPFSESILPLQVNLSRKGEWLPTHSPSSVLLQGGYSG
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgtcccaaatggagctggctttggaccctggtgatcaggatctgctgggcttcctgctg
gaggaaagcggagatttgtggcctgagcccgaccggtacgcggaggcgccgctggactgg
gagctgcggtcttcagagaactccgtgcaggccctgagcgactgggaagtagaggattta
ctgagctctctgctcagtccctcggcgtcgccggacgttctcgactcctccaactcttct
gtccaccatgaccacacttactccctcccacaggaacacgtctctatagatctagatagt
gggagctgtgaaaaggaggggtcatgtttgactccgctgcttgtggaggaggcagcagag
caggtccttgagttttcaggattatcgccaccttgcacgactggggacaagagttcccat
ttctctctgacaacccagtgcaagtctgctgtccaccattcccaggagatttccaggctg
aacctgacagaggaggagaagaggcttttggagaaggaggggtttactctgccctccatg
cgtcctctcactaagatggaggaacaagttctgaaacgagtacggaggaagattcgcaac
aagagatctgctcaagagagccggaagaagaaaaaggtgtatgtaggggggctagagagc
agggtcttgaaatacacagcccagaatcaggagctacagaacaaagtacagctcctagag
gaacagaatctgtctcttttagatcaactaaggagactccaggccatggtgattgagata
gcaaacaaaagtagcagtggcagtacatgtgtcctggtcctactgttctctttctgcctc
ctccttgtacctgccatgtactcctctgacacaagggggaacatgcctgctgagtatgtt
gcgctgcaccgccagcttcgtaccctgcgcagtgaggaccctcagcagctgaagctgcct
gctctgcagtcagaggtaccaagggacagcacaggccagttgctggacagttcagaacat
acactccaggcctctagcaacttttcctgcctgttgtaccacatgcctcaggcagagcct
cctttgcagcagccactccctgacctctcccaagagacccccttctcagagtccatcctt
cccctgcaggtaaatctctcaagaaagggggaatggctccctacccacagcccttcatct
gtcctcttgcagggcgggtattctggttaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744440
Entry
103744440         CDS       T03372                                 

Gene name
Creb1
Definition
(RefSeq) cAMP responsive element binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04380  Osteoclast differentiation
ngi04612  Antigen processing and presentation
ngi04668  TNF signaling pathway
ngi04710  Circadian rhythm
ngi04713  Circadian entrainment
ngi04714  Thermogenesis
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04911  Insulin secretion
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04922  Glucagon signaling pathway
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04931  Insulin resistance
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04962  Vasopressin-regulated water reabsorption
ngi05016  Huntington disease
ngi05020  Prion disease
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05034  Alcoholism
ngi05152  Tuberculosis
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05203  Viral carcinogenesis
ngi05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103744440 (Creb1)
   04024 cAMP signaling pathway
    103744440 (Creb1)
   04022 cGMP-PKG signaling pathway
    103744440 (Creb1)
   04151 PI3K-Akt signaling pathway
    103744440 (Creb1)
   04152 AMPK signaling pathway
    103744440 (Creb1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    103744440 (Creb1)
  09152 Endocrine system
   04911 Insulin secretion
    103744440 (Creb1)
   04922 Glucagon signaling pathway
    103744440 (Creb1)
   04915 Estrogen signaling pathway
    103744440 (Creb1)
   04926 Relaxin signaling pathway
    103744440 (Creb1)
   04935 Growth hormone synthesis, secretion and action
    103744440 (Creb1)
   04918 Thyroid hormone synthesis
    103744440 (Creb1)
   04928 Parathyroid hormone synthesis, secretion and action
    103744440 (Creb1)
   04916 Melanogenesis
    103744440 (Creb1)
   04924 Renin secretion
    103744440 (Creb1)
   04925 Aldosterone synthesis and secretion
    103744440 (Creb1)
   04927 Cortisol synthesis and secretion
    103744440 (Creb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103744440 (Creb1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103744440 (Creb1)
  09156 Nervous system
   04725 Cholinergic synapse
    103744440 (Creb1)
   04728 Dopaminergic synapse
    103744440 (Creb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103744440 (Creb1)
  09149 Aging
   04211 Longevity regulating pathway
    103744440 (Creb1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    103744440 (Creb1)
   04713 Circadian entrainment
    103744440 (Creb1)
   04714 Thermogenesis
    103744440 (Creb1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103744440 (Creb1)
  09162 Cancer: specific types
   05215 Prostate cancer
    103744440 (Creb1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103744440 (Creb1)
   05020 Prion disease
    103744440 (Creb1)
  09165 Substance dependence
   05030 Cocaine addiction
    103744440 (Creb1)
   05031 Amphetamine addiction
    103744440 (Creb1)
   05034 Alcoholism
    103744440 (Creb1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103744440 (Creb1)
   04934 Cushing syndrome
    103744440 (Creb1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103744440 (Creb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103744440 (Creb1)
   05161 Hepatitis B
    103744440 (Creb1)
   05163 Human cytomegalovirus infection
    103744440 (Creb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103744440 (Creb1)
   05165 Human papillomavirus infection
    103744440 (Creb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103744440 (Creb1)
   03029 Mitochondrial biogenesis [BR:ngi03029]
    103744440 (Creb1)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103744440 (Creb1)
Mitochondrial biogenesis [BR:ngi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    103744440 (Creb1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 103744440
NCBI-ProteinID: XP_008844412
LinkDB
Position
Un
AA seq 341 aa
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgctgctgtaacagaagct
gaaaatcaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatcc
atgccagcagctcatgcaacatcatctgctcccactgtaactttagtacaactgcccaat
gggcagacagttcaagtccatggagttattcaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagtcttcctgtaaggacttaaaaagacttttctccggaaca
cagatttcaaccattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaaacgaagggaaattctttcaaggaggccttcctacaggaaaattttgaatgat
ttatcttctgatgcaccaggagtgccaaggattgaagaagaaaagtcggaagaggagact
tcagcccctgccatcaccactgtaacggtgccaactccaatttaccaaactagcagtgga
cagtacattgccattacccagggaggagcaatacaactggctaacaatggtaccgatggg
gtacagggcctgcaaacgctaaccatgaccaatgcagctgccactcagcctggtactacc
attctacagtatgcacagaccactgatggacagcagattctagtgcccagcaaccaagtt
gttgttcaagctgcttctggcgatgtacaaacatatcagattcgcacagcacccactagc
accattgcccctggcgttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcacggaagagagaggttcgtctaatgaagaacagggaagcagcacgagaatgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaac
caaaacaagacactgattgaggagctaaaagcacttaaggacctttactgccacaaatcg
gattaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748563
Entry
103748563         CDS       T03372                                 

Gene name
Atf4
Definition
(RefSeq) activating transcription factor 4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04137  Mitophagy - animal
ngi04141  Protein processing in endoplasmic reticulum
ngi04151  PI3K-Akt signaling pathway
ngi04210  Apoptosis
ngi04211  Longevity regulating pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04668  TNF signaling pathway
ngi04720  Long-term potentiation
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04918  Thyroid hormone synthesis
ngi04922  Glucagon signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04932  Non-alcoholic fatty liver disease
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi05010  Alzheimer disease
ngi05012  Parkinson disease
ngi05014  Amyotrophic lateral sclerosis
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05034  Alcoholism
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05203  Viral carcinogenesis
ngi05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103748563 (Atf4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103748563 (Atf4)
   04668 TNF signaling pathway
    103748563 (Atf4)
   04022 cGMP-PKG signaling pathway
    103748563 (Atf4)
   04151 PI3K-Akt signaling pathway
    103748563 (Atf4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103748563 (Atf4)
  09143 Cell growth and death
   04210 Apoptosis
    103748563 (Atf4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103748563 (Atf4)
   04922 Glucagon signaling pathway
    103748563 (Atf4)
   04912 GnRH signaling pathway
    103748563 (Atf4)
   04915 Estrogen signaling pathway
    103748563 (Atf4)
   04926 Relaxin signaling pathway
    103748563 (Atf4)
   04935 Growth hormone synthesis, secretion and action
    103748563 (Atf4)
   04918 Thyroid hormone synthesis
    103748563 (Atf4)
   04928 Parathyroid hormone synthesis, secretion and action
    103748563 (Atf4)
   04925 Aldosterone synthesis and secretion
    103748563 (Atf4)
   04927 Cortisol synthesis and secretion
    103748563 (Atf4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103748563 (Atf4)
  09156 Nervous system
   04725 Cholinergic synapse
    103748563 (Atf4)
   04728 Dopaminergic synapse
    103748563 (Atf4)
   04720 Long-term potentiation
    103748563 (Atf4)
   04722 Neurotrophin signaling pathway
    103748563 (Atf4)
  09149 Aging
   04211 Longevity regulating pathway
    103748563 (Atf4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103748563 (Atf4)
  09162 Cancer: specific types
   05215 Prostate cancer
    103748563 (Atf4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103748563 (Atf4)
   05012 Parkinson disease
    103748563 (Atf4)
   05014 Amyotrophic lateral sclerosis
    103748563 (Atf4)
   05020 Prion disease
    103748563 (Atf4)
   05022 Pathways of neurodegeneration - multiple diseases
    103748563 (Atf4)
  09165 Substance dependence
   05030 Cocaine addiction
    103748563 (Atf4)
   05031 Amphetamine addiction
    103748563 (Atf4)
   05034 Alcoholism
    103748563 (Atf4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103748563 (Atf4)
   04934 Cushing syndrome
    103748563 (Atf4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103748563 (Atf4)
   05161 Hepatitis B
    103748563 (Atf4)
   05163 Human cytomegalovirus infection
    103748563 (Atf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103748563 (Atf4)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    103748563 (Atf4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 MCU AAA_13 Laminin_II DUF2968 DUF3450 CENP-F_leu_zip Fez1 bZIP_Maf Nop53
Other DBs
NCBI-GeneID: 103748563
NCBI-ProteinID: XP_008849441
LinkDB
Position
Un
AA seq 350 aa
MTEMSFLNSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSGDKAKAGSSE
WLAADGLVNASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLATLDDTC
DLFAPLVQETNKESPQTANPIGHLPESLTKTDQVAPFAFLQPLPFAPGVLSSTPDHSFSL
ELGSEVDISEGDRRPDSAAYITVIPQCVKEEDTPSDNDSGICMSPESYLGSPQHSPSTSR
ASPSSLPSPGISHGSPRPKPYDPPGDKAATKVKVEKLDKKLKKMEQNKTAATRYRQKKRA
EQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgaccgagatgagcttcctgaacagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcttaggtctcttagatgactacctggaggtg
gccaagcacttcaaacctcatgggttctccggcgacaaggctaaggcgggctcctccgaa
tggctggctgcggatgggttggtcaatgcctcagataccggcaaggaggatgccttttcc
ggaacagattggatgttggagaaaatggatctgaaggagtttgacttcgatgccctgttt
cgaatggatgacctggaaaccatgccagatgagcttttggccacgttggatgacacatgt
gatctttttgcccctctagtccaagagactaataaggagtccccccagacagcgaaccca
attggccatctcccagagagtttaacgaaaaccgaccaggttgccccctttgccttcttg
caacctcttccctttgccccaggggtcctgtcttccactccagatcattcctttagttta
gagctaggcagtgaagttgatatctctgaaggagaccggaggcctgacagtgctgcttac
attactgtgatccctcagtgtgtaaaagaggaagacaccccctcagataatgatagtggc
atctgtatgagccctgagtcctacctgggctctccccagcatagcccctccacctccagg
gcatctccaagcagtctgccttctccaggtattagccatgggtctcctcgccccaaacct
tatgaccctccaggagataaggcggcaacgaaagtaaaggttgaaaagctggataagaag
ctcaaaaaaatggagcaaaacaagactgcagccactaggtaccgccagaaaaagcgggca
gagcaggaagcccttactggtgagtgtaaagagctagaaaagaagaatgaagctctcaaa
gagaaggcagattcgctggctaaagagatccagtatctgaaagatttgatagaagaggtc
cgcaaggcaagggggaagaagagagttccctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748795
Entry
103748795         CDS       T03372                                 

Gene name
Creb3l1
Definition
(RefSeq) cAMP responsive element binding protein 3 like 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04668  TNF signaling pathway
ngi04714  Thermogenesis
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04911  Insulin secretion
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04922  Glucagon signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04931  Insulin resistance
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04962  Vasopressin-regulated water reabsorption
ngi05016  Huntington disease
ngi05020  Prion disease
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05034  Alcoholism
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05203  Viral carcinogenesis
ngi05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103748795 (Creb3l1)
   04024 cAMP signaling pathway
    103748795 (Creb3l1)
   04022 cGMP-PKG signaling pathway
    103748795 (Creb3l1)
   04151 PI3K-Akt signaling pathway
    103748795 (Creb3l1)
   04152 AMPK signaling pathway
    103748795 (Creb3l1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103748795 (Creb3l1)
   04922 Glucagon signaling pathway
    103748795 (Creb3l1)
   04915 Estrogen signaling pathway
    103748795 (Creb3l1)
   04926 Relaxin signaling pathway
    103748795 (Creb3l1)
   04935 Growth hormone synthesis, secretion and action
    103748795 (Creb3l1)
   04918 Thyroid hormone synthesis
    103748795 (Creb3l1)
   04928 Parathyroid hormone synthesis, secretion and action
    103748795 (Creb3l1)
   04916 Melanogenesis
    103748795 (Creb3l1)
   04925 Aldosterone synthesis and secretion
    103748795 (Creb3l1)
   04927 Cortisol synthesis and secretion
    103748795 (Creb3l1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103748795 (Creb3l1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103748795 (Creb3l1)
  09156 Nervous system
   04725 Cholinergic synapse
    103748795 (Creb3l1)
   04728 Dopaminergic synapse
    103748795 (Creb3l1)
  09149 Aging
   04211 Longevity regulating pathway
    103748795 (Creb3l1)
  09159 Environmental adaptation
   04714 Thermogenesis
    103748795 (Creb3l1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103748795 (Creb3l1)
  09162 Cancer: specific types
   05215 Prostate cancer
    103748795 (Creb3l1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103748795 (Creb3l1)
   05020 Prion disease
    103748795 (Creb3l1)
  09165 Substance dependence
   05030 Cocaine addiction
    103748795 (Creb3l1)
   05031 Amphetamine addiction
    103748795 (Creb3l1)
   05034 Alcoholism
    103748795 (Creb3l1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103748795 (Creb3l1)
   04934 Cushing syndrome
    103748795 (Creb3l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103748795 (Creb3l1)
   05161 Hepatitis B
    103748795 (Creb3l1)
   05163 Human cytomegalovirus infection
    103748795 (Creb3l1)
   05165 Human papillomavirus infection
    103748795 (Creb3l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103748795 (Creb3l1)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103748795 (Creb3l1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 Spc29 ELP6 Jnk-SapK_ap_N DUF4337 TPR_MLP1_2 APG6_N HAUS-augmin3 Tcf25 ADIP JMY DUF724
Other DBs
NCBI-GeneID: 103748795
NCBI-ProteinID: XP_008849808
LinkDB
Position
Un
AA seq 519 aa
MDAVLEPFPTDRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFVENMEDFSNDLFSSFFD
DPMLDEKSPLLDMELDSPAPGIQAEHSYSLSGDSAPQSPLVPIKMENTTQDVEHGAWALG
HKLCSIMVKQEQSSELPVDPLAASSAMAASAIATPPLLGLSPLSRLPIPHQAPGEMTQLP
VIKAEPQEVNQFLKMTSEDLVQMPPTPPSSHGSDSDGSQSPHSLPPSSPVRPMARASTAI
STSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKNK
ISAQESRRKKKEYVECLEKKVETYTSENNELWKKVETLENANRTLLQQLQKLQTLVTSKI
SRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSSSKAVKEDPITADSVYTASQMP
SRSLLFYDDGAGSWEDGRGTLLPVEPPEGWELKPGGPAEPRPQDHLQHDYLDGTHETTKY
LSETWPEDASGNGTSPNFSHPKEWFHDRDLGPNTTIKLS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggacgcggtcttggaacccttcccgaccgacaggctgttcccgggatccagtttccta
gacctgggagatctgaacgagtcggatttcctcaacaatgcgcacttcccagagcacctg
gaccatttcgtggagaacatggaggacttctctaatgacctgttcagcagtttctttgat
gaccccatgctagatgaaaagagccctctgctggacatggaactggactccccagcacca
ggcatccaggctgagcacagctactccctgagtggggactctgcaccccagagccccctg
gtgcccatcaagatggagaacaccacccaagacgtggaacatggagcatgggcactggga
cacaaactatgctccatcatggtgaagcaggagcagagctcagagcttcccgtcgaccct
ctggctgcctcctctgccatggctgcctctgccatagccactccaccactgctgggcctc
agccccctctccagactgcctataccccaccaggccccaggagagatgactcagctgcca
gtgatcaaagcagagccccaggaagtgaaccagttcctcaaaatgacatcagaggatctg
gtacagatgcctccaacaccccccagcagtcatggcagcgacagcgacggctcccagagt
ccccactctctgcctccctccagccctgtccggcccatggcccgcgcctccacagccatc
tccacctctccgctcctcactgcccctcataaactacaggggacatctgggccactgctc
ctgacagaagaggagaagcgaaccctgattgcagaggggtaccccatccccaccaaactc
cccctcactaaagccgaggagaaggccttgaagagggtgcgcagaaaaatcaagaacaag
atctcagcccaggagagccgccgtaagaagaaggaatatgtggagtgtctagaaaagaag
gtggagacatatacatcagagaacaatgagctgtggaagaaggtggagaccctggagaat
gccaacagaaccctgctccagcagctgcagaaactccagactctggtcaccagcaagatc
tccagaccttacaagatggcagccactcagacaggcacctgtctcatggtggcggccttg
tgctttgttctggtgctgggctccctggtgccctgccttcctgaattctcctccagctcc
aaggctgtgaaggaagaccctatcacagccgacagtgtctacacagccagtcagatgccc
tcccgaagcctcctgttctatgatgatggggcaggctcatgggaagatggccgaggcacc
ctgctacctgtggagcccccagaaggctgggaactcaagccagggggcccagcagagcca
aggccccaggaccacctccaacatgattatctggatggcacccacgagaccaccaagtac
ttgagcgagacctggccagaggatgctagtggcaatggcaccagccccaacttctcccac
cccaaggagtggtttcatgacagggatctgggccccaacaccaccatcaaactctcctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751688
Entry
103751688         CDS       T03372                                 

Gene name
Creb3l4
Definition
(RefSeq) cAMP responsive element binding protein 3 like 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04668  TNF signaling pathway
ngi04714  Thermogenesis
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04911  Insulin secretion
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04922  Glucagon signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04931  Insulin resistance
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04962  Vasopressin-regulated water reabsorption
ngi05016  Huntington disease
ngi05020  Prion disease
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05034  Alcoholism
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05203  Viral carcinogenesis
ngi05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103751688 (Creb3l4)
   04024 cAMP signaling pathway
    103751688 (Creb3l4)
   04022 cGMP-PKG signaling pathway
    103751688 (Creb3l4)
   04151 PI3K-Akt signaling pathway
    103751688 (Creb3l4)
   04152 AMPK signaling pathway
    103751688 (Creb3l4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103751688 (Creb3l4)
   04922 Glucagon signaling pathway
    103751688 (Creb3l4)
   04915 Estrogen signaling pathway
    103751688 (Creb3l4)
   04926 Relaxin signaling pathway
    103751688 (Creb3l4)
   04935 Growth hormone synthesis, secretion and action
    103751688 (Creb3l4)
   04918 Thyroid hormone synthesis
    103751688 (Creb3l4)
   04928 Parathyroid hormone synthesis, secretion and action
    103751688 (Creb3l4)
   04916 Melanogenesis
    103751688 (Creb3l4)
   04925 Aldosterone synthesis and secretion
    103751688 (Creb3l4)
   04927 Cortisol synthesis and secretion
    103751688 (Creb3l4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103751688 (Creb3l4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103751688 (Creb3l4)
  09156 Nervous system
   04725 Cholinergic synapse
    103751688 (Creb3l4)
   04728 Dopaminergic synapse
    103751688 (Creb3l4)
  09149 Aging
   04211 Longevity regulating pathway
    103751688 (Creb3l4)
  09159 Environmental adaptation
   04714 Thermogenesis
    103751688 (Creb3l4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103751688 (Creb3l4)
  09162 Cancer: specific types
   05215 Prostate cancer
    103751688 (Creb3l4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103751688 (Creb3l4)
   05020 Prion disease
    103751688 (Creb3l4)
  09165 Substance dependence
   05030 Cocaine addiction
    103751688 (Creb3l4)
   05031 Amphetamine addiction
    103751688 (Creb3l4)
   05034 Alcoholism
    103751688 (Creb3l4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103751688 (Creb3l4)
   04934 Cushing syndrome
    103751688 (Creb3l4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103751688 (Creb3l4)
   05161 Hepatitis B
    103751688 (Creb3l4)
   05163 Human cytomegalovirus infection
    103751688 (Creb3l4)
   05165 Human papillomavirus infection
    103751688 (Creb3l4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103751688 (Creb3l4)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103751688 (Creb3l4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB ATG16 DUF4407 JMY MscS_porin HAUS-augmin3 OppC_N EMP24_GP25L MCU YabA DUF3287 Jnk-SapK_ap_N DUF1664 HALZ DUF2207 KASH_CCD DUF724 Spc7
Other DBs
NCBI-GeneID: 103751688
NCBI-ProteinID: XP_008853422
LinkDB
Position
Un
AA seq 394 aa
MELRCPDSLETLLEPPEDIFATGSFLELGLNSSPSEVPVTRLQEQGLQGWEISGGHDCGL
QESEPEDFLKLFIDPNMVYCSEASPGSDSGISEDPGCSDRSPAPQTPSSPALYEVVYEAG
ALQNTQGEARPTFGLISIQLDQWRPAFVVPDACTVSGLPSDTHTYNLPRTSTLAPAPPAA
LLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSAQNQELQKKVQELERRNISLVAQLHQLQALISQTSNKAAQTSTCVLI
LLFSLALIILPSFSPFQGLSEAGPEDYQPHGVISRNILTHKDMTESLETPVVKSKLGRPP
GAQTAKGSTKTQLKTGVKSESSRQIRTVLHADEM
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggagctccggtgtcctgactcgctggagactttgctggagcccccagaagatatcttc
gccacaggatccttcctggagttggggctcaactcttccccttcagaggttcctgtgact
aggctacaagaacaggggctgcaaggctgggaaataagtgggggccatgactgtggcctt
caagagagtgagcctgaagatttcctgaagcttttcattgatcccaatatggtatactgc
tcagaagcgtctcctggcagtgacagtggcatctctgaggaccctggctgttcagaccgc
tcccctgccccacagacacccagttctcctgcactgtatgaggttgtctatgaggcaggg
gccctgcagaacacacagggggaagccaggccaactttcggactcatctccatccagctg
gaccagtggagacctgcattcgtagtgcccgatgcctgcactgtcagtgggctgccctct
gatactcatacatacaacctacccagaaccagcaccttagccccagcacctcctgcagcc
ctgctgccctgccaaacactgttcctgacagatgaggagaagcgtctgctggggcaagaa
ggggtttctctgccctctcacctgccccttaccaaggcagaggagagagttctcaagaag
gtcaggagaaaaatccgcaacaagcagtcagctcaggacagccggcggcggaagaaagaa
tacattgatgggctagagagcagagtggcagcctgttcagcacagaaccaggaactacag
aaaaaagtccaggagctggagaggcggaatatctccttggtggctcagctccaccagcta
caggcgctcatctcccaaacctccaacaaagctgctcagaccagcacctgtgttctgatt
ctgcttttttccctggctctcatcatcctgcctagcttcagcccctttcagggtctatca
gaagctgggcctgaggattatcagcctcatggagtgatttccagaaatatcttgactcac
aaggacatgacagaaagcctagagactccagtggtaaagtccaaattggggaggccacct
ggagcccagactgcaaagggttcaacaaagacacagctaaagactggagtgaagtctgaa
tccagcaggcaaatcaggacagtgttgcatgcggatgagatgtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751761
Entry
103751761         CDS       T03372                                 

Gene name
Atf2
Definition
(RefSeq) activating transcription factor 2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04211  Longevity regulating pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04668  TNF signaling pathway
ngi04714  Thermogenesis
ngi04728  Dopaminergic synapse
ngi04911  Insulin secretion
ngi04915  Estrogen signaling pathway
ngi04918  Thyroid hormone synthesis
ngi04922  Glucagon signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi05020  Prion disease
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05034  Alcoholism
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103751761 (Atf2)
   04668 TNF signaling pathway
    103751761 (Atf2)
   04022 cGMP-PKG signaling pathway
    103751761 (Atf2)
   04151 PI3K-Akt signaling pathway
    103751761 (Atf2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103751761 (Atf2)
   04922 Glucagon signaling pathway
    103751761 (Atf2)
   04915 Estrogen signaling pathway
    103751761 (Atf2)
   04926 Relaxin signaling pathway
    103751761 (Atf2)
   04935 Growth hormone synthesis, secretion and action
    103751761 (Atf2)
   04918 Thyroid hormone synthesis
    103751761 (Atf2)
   04928 Parathyroid hormone synthesis, secretion and action
    103751761 (Atf2)
   04925 Aldosterone synthesis and secretion
    103751761 (Atf2)
   04927 Cortisol synthesis and secretion
    103751761 (Atf2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103751761 (Atf2)
  09156 Nervous system
   04728 Dopaminergic synapse
    103751761 (Atf2)
  09149 Aging
   04211 Longevity regulating pathway
    103751761 (Atf2)
  09159 Environmental adaptation
   04714 Thermogenesis
    103751761 (Atf2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103751761 (Atf2)
  09164 Neurodegenerative disease
   05020 Prion disease
    103751761 (Atf2)
  09165 Substance dependence
   05030 Cocaine addiction
    103751761 (Atf2)
   05031 Amphetamine addiction
    103751761 (Atf2)
   05034 Alcoholism
    103751761 (Atf2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103751761 (Atf2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103751761 (Atf2)
   05161 Hepatitis B
    103751761 (Atf2)
   05163 Human cytomegalovirus infection
    103751761 (Atf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103751761 (Atf2)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    103751761 (Atf2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 103751761
NCBI-ProteinID: XP_008853522
LinkDB
Position
Un
AA seq 506 aa
MKFRLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDDKDVSLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIAMPPSSQHSPQEVD
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgaaattcaggttacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagacaccaacaccaacaagattcttaaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccatttgaaaatgaattcaagaaagcttca
gaagatgacattaaaaaaatgcctctagatttgtcccctcttgcaacacccatcataaga
agcaaaatcgaagaaccttctgttgtagaaacaactcatcaagatagtcctttacctcac
ccagagtctactaccagtgatgacaaggatgtatcattggcacaaactgcacagcccaca
tcagctattgttcgtccagcatcattacaggttcccaatgtgctgctcacaagttctgac
tcaagcgtaattattcagcaagcagtaccgtcaccaacctcaagtactgtaatcacccag
gcaccctcctctaacaggccaattgtccctgtaccaggcccatttcctcttctgttacat
cttcctaatggacaaaccatgcccgttgctattcctgcatcaattacaagttctaatgtg
catgttccagctgcagtcccacttgttcgaccagtcaccatggtgcctagtgttccagga
attccaggcccttcttcccctcaaccagtacagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggtgatactgtcaaaggtcatggcagt
ggattggttaggactcagtcagaagaatctcgtccacagtcattacaacagccagccacc
tccactacagaaactccggcttctccagctcacacaactccacaaacccaaaatacaagt
ggtcgtcgaagaagagcagctaatgaagatcctgatgagaagaggagaaagtttctagaa
cgaaatagagcagcagcttcaaggtgccgacaaaaaagaaaggtctgggttcagtcctta
gagaagaaagcagaagacctgagttcattaaacggccagctgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatccggctatcatactgctgataaagatgatagttcagaagac
ctttcggtgcccagtagtccacacacagaagctatccaacatagttctgtcagcacatcc
aatggagtcagttcaacatcaaaggcagaagctgtagccacttcagtcctcacccagatg
gcagaccagagtacggagccagcgctttcacagattgccatgcctccttcctcccagcac
agccctcaggaagttgattaa

DBGET integrated database retrieval system