KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724501
Entry
103724501         CDS       T03372                                 

Gene name
Nos2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00220  Arginine biosynthesis
ngi00330  Arginine and proline metabolism
ngi01100  Metabolic pathways
ngi04020  Calcium signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04146  Peroxisome
ngi04371  Apelin signaling pathway
ngi04926  Relaxin signaling pathway
ngi05010  Alzheimer disease
ngi05014  Amyotrophic lateral sclerosis
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05133  Pertussis
ngi05140  Leishmaniasis
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05146  Amoebiasis
ngi05152  Tuberculosis
ngi05200  Pathways in cancer
ngi05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103724501 (Nos2)
   00330 Arginine and proline metabolism
    103724501 (Nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103724501 (Nos2)
   04066 HIF-1 signaling pathway
    103724501 (Nos2)
   04020 Calcium signaling pathway
    103724501 (Nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103724501 (Nos2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103724501 (Nos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103724501 (Nos2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    103724501 (Nos2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103724501 (Nos2)
   05014 Amyotrophic lateral sclerosis
    103724501 (Nos2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    103724501 (Nos2)
   05152 Tuberculosis
    103724501 (Nos2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103724501 (Nos2)
   05145 Toxoplasmosis
    103724501 (Nos2)
   05140 Leishmaniasis
    103724501 (Nos2)
   05142 Chagas disease
    103724501 (Nos2)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     103724501 (Nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 103724501
NCBI-ProteinID: XP_008819816
LinkDB
Position
Un
AA seq 1144 aa
MACPWKFLFRNKSYQCDLVEEKDINNNVWKTLGAIPNPTTQDDLKSHSPAKHQNGYPQPL
TGTAQNAPESLEKLQVLPSTRPQHMKIKNWGSGEILQDTLHHKATSEFSCRSKSCLGSIM
NSRSLTRGPRDKPTSLEELLPQAIEFINQYYGSFKEAKIEEHLARVEAITKEIETTGTYQ
LTYDELIFATKLAWRNAPRCIGRIQWSNLQVFDARSCCTAQEMFQHICRHVLYATNGGNI
RSTITVFPQRSDGKHDFRIWNSQLIRYAGYQMPDGTIRGDPANLEFTQLCIDLGWKPCYG
RFDVLPLVLQADGRDPEIFEIPPDLVLEVSMEHPKYEWFQELGLKWYALPAVANMLLEVG
GLEFPACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETNTLASLWKDRAVMEINV
AVLYSFKKQNVTIMDHHTATESFIKHMQNEHRARGGCPADWIWLVPPMSGSITPVFHQEM
LNYILSPFYYYQIEPWKTHIWQDGELRPRKREIRFKVLVKAVLFASVLMHKVMASRVRVT
ILFATETGKSEVLAQDLAALFSYAFNSKVVCMNKYKLSNLKDEQLLLVVTSTFGNGDCPG
NGQTLKKSLFMLKELTHIFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGD
ELTGQEDAFRSWAVQTFKAACEAFDVRSKHHIQIPKRYTSNVIWEPQNYRLTQSSESLDL
NKALSSMHTKNVFTMRLKSQQNLQSSKSSRTTLLVQLSCEDCQGLSHLPGEHLGVFPSNQ
TALVQGILERVVNCPEPHQTVCLELLDESGSYWIRDKRLPPCSLIQALTYFLDITTPPTQ
LQLHKLARLATEEAERQKLEALCQPSEYNKWKFSNSPTFLEVLEEFPSLQVPAAFLLSQL
PILKPRYYSISSSRDHMPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWISSLKPQDPVPCF
VRSVSGFQLPENPSQPCILIGPGTGIAPFRSFWQQRLHDSQHKGLKGGRMTLVFGCRNPE
EDHLYQEEMLEMARKGVLHQVHTAYSRLPGKPKVYVQDILQRQLADEVFRVLQEEQGHLY
VCGDVRMAQDVAYTLKQLVAARLSLSEEQVEDYFFQLKSQKRYHEDIFGAVFPYGVKKDR
IMGL
NT seq 3435 nt   +upstreamnt  +downstreamnt
atggcctgcccctggaagtttctgttcagaaacaaatcctaccagtgtgacttagtggag
gaaaaggacattaacaacaatgtgtggaaaaccctgggtgccattcccaacccaacaaca
caggatgacctcaagagtcacagccctgccaagcaccaaaatgggtacccccaacccctc
actgggacagcacagaatgctccagaatccttggaaaagctgcaagtgcttccatcaacc
cgtccacagcacatgaagatcaaaaattggggcagtggagagattttgcaagacactctt
caccacaaggccacatcggagttctcctgcagatccaaatcttgcttggggtccatcatg
aattccaggagtttgactagaggacccagagacaagcccacctcattggaggaacttcta
cctcaagctatagagttcatcaaccagtattatggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagccataacaaaggagatagaaacaacaggaacctaccag
ctaacatatgacgaactcatctttgccaccaagctggcctggcgcaacgctcctcgctgc
atcggcaggatccagtggtccaacctgcaggtctttgatgcccggagctgttgtactgcc
caggagatgttccaacacatctgcagacatgtgctttatgccaccaatggcggcaacatc
aggtcgaccatcactgtgttcccccagcgaagtgatgggaaacatgacttccggatctgg
aactctcagctcatccggtatgctggctaccagatgcccgatggcaccatcagaggggat
cctgccaacttagagtttacccagttgtgcatcgatctgggctggaagccctgctatggc
cgcttcgatgtgctgcctctggtcctgcaggctgatggcagagaccctgagatcttcgaa
atccctcctgaccttgtgctggaggtgtccatggaacatcccaagtacgagtggttccag
gagctggggctgaagtggtacgccttgcctgctgtggccaacatgctgctggaagtgggt
ggcctcgagttccctgcctgccccttcaatgggtggtacatgggcacggagatcggagta
cgagacttctgtgacacacagcgctacaatatcttggaggaagtgggcagaaggatgggc
ctggagaccaacacactggcctccctctggaaagaccgggctgtcatggagatcaatgtg
gctgtgctttatagtttcaagaagcaaaatgtgaccatcatggaccaccacacagccaca
gagtccttcataaagcacatgcagaatgagcacagggcccgagggggctgccccgccgac
tggatctggctggtccctccgatgtctgggagcatcaccccagtgtttcaccaggagatg
ctgaactacatcttatctccgttctactattatcagatagagccctggaagacccacatc
tggcaggatggggagctgagacccaggaagagagagatccggttcaaagtcttggtaaaa
gcggtgctctttgcttctgtgctaatgcacaaggtcatggcatcccgagtcagagtcaca
atcctctttgcaactgagacagggaaatcagaagtactggcccaggacttggcagccttg
ttcagctatgccttcaactccaaggttgtctgcatgaacaagtacaagctgagcaacttg
aaagatgagcagctactgctggtggtgaccagcacatttgggaatggagactgccctggc
aacggacagactctgaagaaatctctgttcatgctgaaagagctcacccacatcttcagg
tatgccgtgtttggccttggctctagcatgtaccctcagttctgtgcctttgctcatgac
atcgaccagaaactgtcccacttgggagcctctcagcttgccccaacaggggaaggggac
gagctcactgggcaggaagatgccttccgcagctgggctgtacaaaccttcaaggcagcc
tgtgaggcatttgacgttcgaagcaaacaccacattcagatccccaaacgctacacttcc
aacgtgatctgggagccacagaactacaggctcacacagagctcagagtctttagacctc
aacaaagccctcagcagcatgcacaccaagaatgtgttcaccatgaggctgaaatcccaa
cagaatctgcagagttcaaagtccagccgtactaccctcctggtccagctctcctgtgaa
gattgccaaggcttgagccacctgcctggggagcatctcggggttttcccaagcaaccag
acagccctggttcagggaatcttggagcgagtagtaaattgtcctgagcctcaccaaact
gtgtgcctggagttgctagatgagagtggcagctactggatcagggacaagaggctgccc
ccatgctcactcattcaggccctcacctacttcctggacatcaccactcctcccacccag
ctgcaactccataagctggcccggttggccacagaggaggctgagagacagaagctggag
gccctgtgtcagccctcagagtacaacaagtggaagttctccaacagccccacattcctg
gaggtgctggaagagttcccatcactgcaggtgcccgctgccttcctgctgtcccagctt
cccatcctgaagccccgctactattccatcagctcctctcgggaccacatgcccaccgag
atccacctcaccgtggcagtggtcacctaccacactcgagatggccagggtcccctgcac
catggtgtctgcagtacttggatcagcagcctgaagcctcaggacccagtgccctgcttt
gtgcgaagtgtcagtggcttccagcttcccgagaacccctcccagccttgcatcctcatc
gggcctggtacaggcattgcgcccttccgcagtttctggcagcagcggctccatgactcc
cagcacaaagggctcaagggaggccgcatgaccctggtgtttgggtgcaggaacccagag
gaggaccacctctatcaggaggagatgctggagatggcccgcaagggtgtgctgcaccag
gtgcacacagcctactccaggcttccaggcaagcccaaggtctacgttcaagacattctg
cagaggcagctggctgatgaggtgttccgtgtgctccaggaggagcagggccacctctac
gtgtgtggggatgtgcgcatggcccaggatgtggcctacaccttgaagcagctggtagct
gccaggctgagcttgagcgaggagcaggttgaggactatttcttccaactcaagagccag
aaacgttatcacgaagatatctttggtgcagtctttccctatggggtgaagaaggacagg
atcatggggctctga

DBGET integrated database retrieval system