KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724546
Entry
103724546         CDS       T03372                                 

Gene name
Il12b
Definition
(RefSeq) interleukin 12B
  KO
K05425  interleukin 12B
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04620  Toll-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04940  Type I diabetes mellitus
ngi05133  Pertussis
ngi05134  Legionellosis
ngi05140  Leishmaniasis
ngi05142  Chagas disease
ngi05143  African trypanosomiasis
ngi05145  Toxoplasmosis
ngi05146  Amoebiasis
ngi05152  Tuberculosis
ngi05162  Measles
ngi05164  Influenza A
ngi05168  Herpes simplex virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05321  Inflammatory bowel disease
ngi05330  Allograft rejection
ngi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103724546 (Il12b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103724546 (Il12b)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103724546 (Il12b)
   04622 RIG-I-like receptor signaling pathway
    103724546 (Il12b)
   04625 C-type lectin receptor signaling pathway
    103724546 (Il12b)
   04658 Th1 and Th2 cell differentiation
    103724546 (Il12b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103724546 (Il12b)
   05205 Proteoglycans in cancer
    103724546 (Il12b)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103724546 (Il12b)
   05164 Influenza A
    103724546 (Il12b)
   05162 Measles
    103724546 (Il12b)
   05168 Herpes simplex virus 1 infection
    103724546 (Il12b)
  09171 Infectious disease: bacterial
   05133 Pertussis
    103724546 (Il12b)
   05134 Legionellosis
    103724546 (Il12b)
   05152 Tuberculosis
    103724546 (Il12b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103724546 (Il12b)
   05145 Toxoplasmosis
    103724546 (Il12b)
   05140 Leishmaniasis
    103724546 (Il12b)
   05142 Chagas disease
    103724546 (Il12b)
   05143 African trypanosomiasis
    103724546 (Il12b)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103724546 (Il12b)
   05330 Allograft rejection
    103724546 (Il12b)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103724546 (Il12b)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103724546 (Il12b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103724546 (Il12b)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103724546 (Il12b)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103724546 (Il12b)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Cytokines
   103724546 (Il12b)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_3 fn3 Ig_4 Ig_2
Other DBs
NCBI-GeneID: 103724546
NCBI-ProteinID: XP_008819880
LinkDB
Position
Un
AA seq 327 aa
MCRQKLTISWFALVLLASPLMAIWELEKDVYVVELDWYPDAPGETVVLTCDTPEEEGITW
TSDQSSDVLGSGKTLPIHVKEFVDAGRYSCHKGDKVLSHSTLMLHKKEDGIWSTDILKDQ
KDPQNKTFLKCEAVNYSGRFTCWWLTAISTDVKFSVKNSSGSSDSRGVTCGAASLSAENV
TVEHKDYKKYSVACQEEVTCPAAEESLPIELVVEAMYKLKYENYTHSFFIRDIIKPDPPK
NLQVKPLKNSQVEVSWEYPDTWSTPHSYFSLTFSVQTQRKNGQKGELLPTDKTSAKVLCR
RDAKVHVKARDRFYSSSWSEWASASCS
NT seq 984 nt   +upstreamnt  +downstreamnt
atgtgtcgtcagaagctgaccatctcctggtttgccctggtgttgctggcgtctccactc
atggccatatgggaacttgagaaagatgtttatgttgtagagctggactggtaccctgat
gcccctggagaaacagtggtcctcacctgtgacactcctgaggaagagggcatcacctgg
acctcagaccagagcagtgacgtcttaggctctggcaaaaccctgcccatccacgtcaaa
gagtttgtggatgccggccgatacagctgccacaaaggagacaaggtgctgagccattcc
accctgatgcttcacaagaaggaagatgggatttggtccactgatattttaaaggaccag
aaagatccccaaaataagactttcctgaaatgtgaggcagtgaattactccgggcgattt
acctgctggtggctgacggcaatcagcacagacgtgaagttcagtgtcaagaacagcagt
ggctcctctgactcccgaggagtgacgtgtggagcagcgtctctctcagccgagaatgtc
acagtggagcacaaggactacaagaagtactcggtggcatgccaagaggaggtcacctgc
ccagccgccgaggaaagcctgcccatcgagctggtggtggaagccatgtacaagctcaag
tacgagaattacacccacagcttcttcatcagggacatcatcaaaccggacccgcccaag
aacctacaggtgaagcctttgaagaactctcaggtggaggtcagctgggaataccctgac
acctggagcactccacattcctacttctccctgacgttctctgtgcagacccagcgcaag
aatggacagaaaggtgagctcctccccacagacaagacctctgccaaagtcctatgccgc
cgagacgccaaggtccacgtgaaagctcgggatcgcttctatagctcatcttggagcgaa
tgggcttctgcgtcctgcagttag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725970
Entry
103725970         CDS       T03372                                 

Gene name
Il24
Definition
(RefSeq) interleukin 24
  KO
K22668  interleukin 24
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103725970 (Il24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103725970 (Il24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103725970 (Il24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103725970 (Il24)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103725970 (Il24)
SSDB
Motif
Pfam: IL10 IL22 GT-D
Other DBs
NCBI-GeneID: 103725970
NCBI-ProteinID: XP_008821573
LinkDB
Position
Un
AA seq 181 aa
MSSGVQTLSCLSLILLVWNQVSGLRGHEFRFGPCRVENVILLELWEAFRAVKDSVQTQDN
ITSVRLLKPEVLHDVSDAESCYLVHSLLKFYLNTVFKNYHNKRVEFKILKSISTLANNFI
VITSKLRPCQENDMLSIYKSAHRRFLLFKRAFKQLDTEAALTKAFGEVDILLTWMEKFYH
Y
NT seq 546 nt   +upstreamnt  +downstreamnt
atgagctcaggagtacagactctgtcttgcctgagcctgatcctgcttgtctggaaccaa
gtttcagggctccggggccatgaattccgatttgggccttgccgagtggagaacgtgatt
ctcctggaactgtgggaggccttccgggctgtgaaggactctgtgcaaactcaggataac
atcacaagtgtccggctgttgaagccagaggttctgcatgatgtctcggatgctgagagc
tgttaccttgtccacagcctgctgaagttctacttaaacactgttttcaaaaactaccac
aacaaaagagttgaattcaagatcttgaagtcaatctccactctggccaataactttatt
gtcatcacatcaaaactgcgaccttgtcaagaaaatgatatgctttccatttataagagt
gcacataggcgatttctactattcaagagagcattcaaacagctggacacagaagcagct
ttgacgaaagcctttggggaagtggacattctcctgacctggatggagaaattctaccat
tactga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725971
Entry
103725971         CDS       T03372                                 

Gene name
Il20
Definition
(RefSeq) interleukin 20
  KO
K22667  interleukin 20
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103725971 (Il20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103725971 (Il20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103725971 (Il20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103725971 (Il20)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103725971 (Il20)
SSDB
Motif
Pfam: IL10
Other DBs
NCBI-GeneID: 103725971
NCBI-ProteinID: XP_008821574
LinkDB
Position
Un
AA seq 169 aa
MKGSGLAFDLLFAVFLTPWTPSTGLKTLHLGSCVITTNLQAIQNGFSEIRDSVQAKDENI
DIRILRQTGSLYDTKPSDRCCLLRHLLRLYLDRVFKNYQTMDHHILXRISSLANSFLTIK
KDLWVFHTHMAYHCGEEAMEKYSWILSHFKEAYAALGLVGVGVFLEVIL
NT seq 510 nt   +upstreamnt  +downstreamnt
atgaaaggctctggtcttgcctttgatcttctctttgctgtgtttttaactccctggact
ccgtctactgggctcaagactctccatttgggaagctgtgtgatcactacaaacctccag
gcaatacaaaatggattctctgagattcgggatagcgtgcaagccaaagatgaaaacatc
gacatcagaatcttgaggcagactgggtctttgtatgacacaaagccttcagatagatgc
tgcctcctccgtcatttactgagactctatctggacagggtattcaaaaactaccagacc
atggaccatcatattctctgaagaatcagcagtcttgccaattcctttcttaccatcaag
aaggacctctgggtctttcacactcacatggcatatcattgtggggaagaagccatggag
aaatacagctggattctgagtcacttcaaagaggcatatgctgctttgggattggttggg
gtgggtgtgttcttggaagtgatattatag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725972
Entry
103725972         CDS       T03372                                 

Gene name
Il19
Definition
(RefSeq) interleukin 19
  KO
K05444  interleukin 19
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103725972 (Il19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103725972 (Il19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103725972 (Il19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103725972 (Il19)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103725972 (Il19)
SSDB
Motif
Pfam: IL10 Cu2_monoox_C Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 103725972
NCBI-ProteinID: XP_008821575
LinkDB
Position
Un
AA seq 176 aa
MKAQCISHCLLGMTLILYSVHTHSLRRCLISVDMRLIEKSFHEIKRALQNKDTFQNVTIL
STLQSLKTIKPIDVCCVTKNLLTFYKDRVFKDHQELSPQILRNISNIANSFLYMQRALQQ
CGQRWCQCSQEAINATRIVHDNYNQLEVRSAALKSLGELDIFLAWIDKNHQETSAT
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaggcacagtgcatttctcactgtctcctgggcatgacactcatcctttactcggta
cacacccacagtctcaggagatgtcttatttctgtggatatgcgccttatagaaaagagt
ttccatgaaatcaaaagagccctgcaaaataaggatactttccaaaatgtcactatcctg
tctacactgcagagtctaaagaccattaagcccatagatgtgtgctgcgtaaccaagaac
ctcctgacattctacaaggacagggtgttcaaggatcatcaggagctgagcccccagatc
ttaaggaacatcagcaacattgccaactctttcctctacatgcagagagctctgcagcaa
tgtgggcagagatggtgccagtgcagtcaggaagccatcaatgcaaccagaattgtccac
gacaactacaatcagctggaagttcgatctgctgcccttaagtccctgggagagttggac
atctttctagcctggattgacaagaatcatcaggaaacttctgctacttga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725974
Entry
103725974         CDS       T03372                                 

Gene name
Il10
Definition
(RefSeq) interleukin 10
  KO
K05443  interleukin 10
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04068  FoxO signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04660  T cell receptor signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi05133  Pertussis
ngi05135  Yersinia infection
ngi05140  Leishmaniasis
ngi05142  Chagas disease
ngi05143  African trypanosomiasis
ngi05144  Malaria
ngi05145  Toxoplasmosis
ngi05146  Amoebiasis
ngi05150  Staphylococcus aureus infection
ngi05152  Tuberculosis
ngi05310  Asthma
ngi05320  Autoimmune thyroid disease
ngi05321  Inflammatory bowel disease
ngi05322  Systemic lupus erythematosus
ngi05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103725974 (Il10)
   04068 FoxO signaling pathway
    103725974 (Il10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103725974 (Il10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103725974 (Il10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103725974 (Il10)
   04660 T cell receptor signaling pathway
    103725974 (Il10)
   04672 Intestinal immune network for IgA production
    103725974 (Il10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103725974 (Il10)
   05133 Pertussis
    103725974 (Il10)
   05150 Staphylococcus aureus infection
    103725974 (Il10)
   05152 Tuberculosis
    103725974 (Il10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103725974 (Il10)
   05144 Malaria
    103725974 (Il10)
   05145 Toxoplasmosis
    103725974 (Il10)
   05140 Leishmaniasis
    103725974 (Il10)
   05142 Chagas disease
    103725974 (Il10)
   05143 African trypanosomiasis
    103725974 (Il10)
  09163 Immune disease
   05310 Asthma
    103725974 (Il10)
   05322 Systemic lupus erythematosus
    103725974 (Il10)
   05320 Autoimmune thyroid disease
    103725974 (Il10)
   05321 Inflammatory bowel disease
    103725974 (Il10)
   05330 Allograft rejection
    103725974 (Il10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103725974 (Il10)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103725974 (Il10)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103725974 (Il10)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Cytokines
   103725974 (Il10)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 103725974
NCBI-ProteinID: XP_008821576
LinkDB
Position
Un
AA seq 181 aa
MPGSALLCCLVLLAGVRTSRGEDTQQVDSCIYFPVSLPHMLRELRTAFGQVKTFFQKKDQ
LDNTLLSESLLQDFKGYLGCQALSEMIQFYLVEVMPQAENHGPDIKEHVNSLGEKLKTLR
LRLRRCHRFLPCENKSKAVEKVKNDFSKLQEKGVYKAMSEFDIFINCIEAYMTVKTKNSN
I
NT seq 546 nt   +upstreamnt  +downstreamnt
atgcctggctcagcactgctatgttgcctggtcttactggccggagtgaggaccagcaga
ggcgaggacacccagcaagtggatagctgcatctacttcccagtcagcctgccgcacatg
ctccgagagctccgcactgcctttggccaggtgaagactttctttcaaaagaaggaccag
ctggacaacacactgttaagcgagtccttgctgcaggactttaagggttacttgggttgc
caagccttgtcagagatgatccagttttacctggtggaagtgatgccccaggcggagaac
catggaccagacatcaaagagcacgtgaattctctgggagagaagctgaagaccctaagg
ctgcgcctgcggcgctgtcatcgatttctcccttgtgaaaataagagcaaggcagtggag
aaggtgaagaatgattttagtaagctccaagaaaaaggtgtctacaaagccatgagtgaa
tttgacatcttcatcaactgcatagaagcatacatgacagtgaagacgaaaaactcaaat
atttag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726340
Entry
103726340         CDS       T03372                                 

Gene name
Ctf1
Definition
(RefSeq) cardiotrophin-1
  KO
K05422  cardiotrophin 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103726340 (Ctf1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103726340 (Ctf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103726340 (Ctf1)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103726340 (Ctf1)
SSDB
Motif
Pfam: PRF pPIWI_RE_X CNTF LIF_OSM
Other DBs
NCBI-GeneID: 103726340
NCBI-ProteinID: XP_008822050
LinkDB
Position
Un
AA seq 204 aa
MSQREGNLEDPQSDSSVSLLPHLEAKIRQTHSLARLLTKYAEQLLEEYVRHQGDPFGLPG
FSPPRLPVAGLSAPAPTHAGLPVRERLRLDAAALDALPGLLDAVRRHQAELNPSAPRLLR
RLEDAARQARALGAAVDTVLAALGALGARGPGPEPAAAAAATVTNTAAGIFSAKVLGLRV
CGLYGEWVSRTEGDLGQLVPGGLA
NT seq 615 nt   +upstreamnt  +downstreamnt
atgagccagagggagggaaatctggaagacccccagtctgactcctcagtctcactcctt
ccccacttggaggccaagattcgccagacacacagccttgcccgcctcctgaccaaatat
gctgagcagctgctggaggaatatgtgcgccaccagggagacccttttgggctgccgggc
ttctcacccccgaggctgccggtggcgggcctgagcgccccggctcccacccacgcgggg
ctgccagtgcgcgagcgcctgcggctggacgcggcggccttggatgcgctgcccgggctg
ctggacgctgtgcgccgccaccaggcggagctgaaccccagcgccccgcgcctgctgcgg
cgcctggaggacgcggcgcgccaggctcgcgcgctgggcgccgctgtggacaccgtgctg
gctgctctgggcgctctgggcgcccgtgggcccggaccggagcccgccgccgccgcagct
gccaccgttaccaacacggctgcgggcatcttctcggccaaggtgctggggctgcgcgtg
tgcggcctctacggcgagtgggtgagccgcaccgagggcgacctgggccagctggtgccc
gggggcctcgcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726417
Entry
103726417         CDS       T03372                                 

Definition
(RefSeq) cardiotrophin-2
  KO
K24382  cardiotrophin 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103726417
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103726417
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103726417
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103726417
SSDB
Motif
Pfam: PRF CNTF LIF_OSM
Other DBs
NCBI-GeneID: 103726417
NCBI-ProteinID: XP_008822198
LinkDB
Position
Un
AA seq 218 aa
MRDYVGGEGPRQKQTREEGRAPLCLLSLLLPPLSPAAPISPSEPISQAYSLALYMQKNTS
TLLQTYLQYQGSPFSDPGFSAPELQLSSLPPAAVSFKIWHAMDDAERLNRVQEAFLALTQ
HLQLVGDDQSDLNPGSPILLTQLGAARLRAQGLMGNMAAIMTALGLPIPPEEDTLGLVPF
GASTFERKCRGYIVTREYGHWTDRAVRDLALLKAKYPA
NT seq 657 nt   +upstreamnt  +downstreamnt
atgagggactatgtggggggagaggggcccaggcagaaacagaccagggaagaagggaga
gcccctctctgcctactgagcctgttgctgccacccctcagtcctgcagcccccatctcc
ccatcagagcccatcagtcaagcctatagtctggccctctatatgcagaagaacacctcg
acattgctacagacgtatctccagtaccagggcagcccctttagtgaccctggcttttca
gcacctgagctccagctcagcagcctgccccctgctgcagtctccttcaagatctggcat
gcaatggatgatgcagagcggctaaaccgtgtccaggaagccttcctggccttgacccag
cacctccagcttgtgggggatgatcagagtgacctgaaccctggcagtcctatcctgctg
acccagctaggagctgcaagactcagggcccaaggcctgatgggcaacatggctgctatc
atgactgccctggggctgcctatccccccagaagaggatactctggggcttgttcctttt
ggagcctccacctttgagaggaaatgcagaggctacatagtgacccgggaatacggtcac
tggacagatcgggctgtgagggacttggctctactcaaggccaaatatccagcttag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726719
Entry
103726719         CDS       T03372                                 

Gene name
Il17d
Definition
(RefSeq) interleukin 17D
  KO
K05492  interleukin 17D
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04657  IL-17 signaling pathway
ngi04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103726719 (Il17d)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103726719 (Il17d)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103726719 (Il17d)
   04659 Th17 cell differentiation
    103726719 (Il17d)
   04657 IL-17 signaling pathway
    103726719 (Il17d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103726719 (Il17d)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103726719 (Il17d)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 103726719
NCBI-ProteinID: XP_008822552
LinkDB
Position
Un
AA seq 209 aa
MLGTLVWMLVAGFLLALAPGRAAGALRAGRRPTRLRGCADRPEELLEQLYGRLAAGVLSA
FHHTLQLGPREQARNTSCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARFPRYLPEAY
CLCRGCLTGLFGEEDFRFRSAPVYSPAVVLRRTAACAGGRSVYAEHYITVPVGCTCVPEP
DKDADGANSSMDKPGAKLLLGPRDGPAGR
NT seq 630 nt   +upstreamnt  +downstreamnt
atgctgggaacactggtctggatgctcgtggccggcttcctactggcgctggcgccgggc
cgcgctgcaggcgcgctgagggcggggaggcgcccgacgcggctgcgaggctgcgcggac
cgacccgaggagctcctggagcagctgtacgggcgactggcggccggcgtgctcagcgcc
ttccaccacacgctgcagctggggccgcgcgagcaagcgcgcaacaccagctgcccggca
gggggcaggcccgccgaccgccgcttccggccgcccaccaacctgcgcagcgtatcgccc
tgggcatacagaatttcctacgacccagcgcgcttcccgaggtacctgccggaggcctac
tgcctgtgccgcggctgcctcaccgggctgttcggcgaggaggacttccgcttccgcagc
gcgccggtctactctcccgccgtagtcctgcgccgcacggcggcctgcgcgggcggccgc
tcggtgtacgccgagcactacatcaccgtcccggtgggttgcacctgcgtgccggagccc
gacaaggacgcggatggcgccaactccagcatggacaagccgggcgccaagctcctgctg
gggcccagggacggccccgcggggcgctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727963
Entry
103727963         CDS       T03372                                 

Gene name
Il7
Definition
(RefSeq) interleukin 7
  KO
K05431  interleukin 7
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103727963 (Il7)
   04151 PI3K-Akt signaling pathway
    103727963 (Il7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103727963 (Il7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103727963 (Il7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103727963 (Il7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103727963 (Il7)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103727963 (Il7)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103727963 (Il7)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Cytokines
   103727963 (Il7)
SSDB
Motif
Pfam: IL7 IL4
Other DBs
NCBI-GeneID: 103727963
NCBI-ProteinID: XP_008824305
LinkDB
Position
Un
AA seq 154 aa
MFHVSFRYIFGIPPLILVLLPVTSSDCHIKDKEGKEYENVLMVSIDELIKMMGTDSSCPN
SEPNFLKKHPCDDTKEAAFLNRAARKLKQFLKMNISEAFNTHLQRVSRGTLEVVNCTSKE
EKNLKEQKKNDSCFLKKLLKEIKTCWNKILNSKT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggaattcctcccttgattcttgttctgctg
ccagtaacttcatctgactgccatattaaagataaagaaggtaaagaatatgagaatgtg
ctaatggtcagcatcgatgaattgatcaaaatgatgggaactgatagcagctgcccgaat
agtgaaccaaactttttaaaaaaacatccatgtgatgatacaaaggaagctgcttttcta
aaccgtgctgctcgcaagttgaagcaatttctcaaaatgaatattagtgaagctttcaat
acccacttacaaagagtttcacgaggcacactagaagtggtgaactgcaccagcaaggaa
gaaaaaaatttaaaggaacagaaaaagaatgactcatgtttcctaaagaaactattgaaa
gaaataaaaacttgttggaataagattttgaacagcaaaacataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730661
Entry
103730661         CDS       T03372                                 

Gene name
Ifne
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04622  RIG-I-like receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103730661 (Ifne)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103730661 (Ifne)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    103730661 (Ifne)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103730661 (Ifne)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interferons
   103730661 (Ifne)
SSDB
Motif
Pfam: Interferon EBV-NA3
Other DBs
NCBI-GeneID: 103730661
NCBI-ProteinID: XP_008827153
LinkDB
Position
Un
AA seq 192 aa
MICKPLLEIVLVLLASSTVFSLEAKLILFQSRMNTRSLQLLNNLQISSIQQCLPHRKNFL
LPQKSVAPYQYQKGHVLAVIQEILQQIFSLFQANVSLVSWEENYIEKFLTVLHQQLEYTE
SLLELEAEERTGALSVRNLRLKIKAYFRRIHDYLENHGYSSCAWIIVQVEINRCLLFVFR
LTGWLSKQETDP
NT seq 579 nt   +upstreamnt  +downstreamnt
atgatttgcaaaccgctccttgaaattgtgttggtgctgctggcttcttccactgtcttc
tccctagaagcgaaactgattctcttccaatcaagaatgaacacaagaagtttacaacta
ctaaataatttgcaaatttcatcaatccagcagtgtctaccccacaggaaaaatttcctg
cttcctcagaagtctgtggctccttaccagtatcaaaaaggacatgtacttgcagttatt
caagagattcttcaacaaatcttcagcctcttccaagcaaatgtttctctagtcagttgg
gaggaaaactacatagagaaatttctcactgtacttcaccaacagctggaatacacagaa
tcactcctggaactggaggcagaggagagaactggtgccttgagtgtgaggaaccttaga
ttaaagattaaagcatacttcagaaggatccatgattacttggaaaatcatgggtacagc
agctgtgcctggatcattgttcaggtagaaatcaacaggtgtctgctctttgtgttcaga
ctgacaggatggctgagcaaacaagaaacagacccttga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730705
Entry
103730705         CDS       T03372                                 

Gene name
Ifnk
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04622  RIG-I-like receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103730705 (Ifnk)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103730705 (Ifnk)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    103730705 (Ifnk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103730705 (Ifnk)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interferons
   103730705 (Ifnk)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103730705
NCBI-ProteinID: XP_017652614
LinkDB
Position
Un
AA seq 196 aa
MTPKRLCLVFLLVLFITPIRSQNCDNMDVTTLKNMKLLSSMIHSPQHCLREIRAFEFPKE
VVPYIQSVKRDIKKALYYMSAQILSLFSYYTSISTQRLEHLQHMERGLLEQLEEVQNCFK
EEDGSQTEEDQMMPSRSKDPQWVYLELSNYFIRIKKFLREKKFSFCAWKIVKAEIRRCFH
FMYNFTKLLNKQSGNF
NT seq 591 nt   +upstreamnt  +downstreamnt
atgactccaaagcgtttatgcctggtgttcctcctggttctgttcattacacccatcaga
tctcagaactgtgataacatggatgttaccaccttgaaaaatatgaaacttctgagcagt
atgatccattctcctcaacattgtctaagagaaatccgggcttttgaatttccaaaagaa
gtcgtgccatacatccagtctgtgaaaagggacatcaagaaggccctctactatatgtct
gctcagattctcagtctcttcagttactatacctccatctccactcagagactggaacac
ctacaacacatggaaaggggacttcttgagcaactggaggaagtgcaaaactgcttcaag
gaagaggacggaagccaaacggaagaggaccagatgatgccctccagatcaaaggacccc
cagtgggtctacctggaattgagcaactatttcatcagaatcaagaagttcctgagagag
aagaaattcagtttctgtgcctggaagattgtcaaagcggaaatcagaagatgtttccac
ttcatgtataacttcacaaaactactcaacaagcaatcaggtaatttttag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731654
Entry
103731654         CDS       T03372                                 

Definition
(RefSeq) interferon alpha-13-like
  KO
K05414  interferon alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04217  Necroptosis
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04623  Cytosolic DNA-sensing pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05320  Autoimmune thyroid disease
ngi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103731654
   04151 PI3K-Akt signaling pathway
    103731654
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103731654
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103731654
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103731654
   04621 NOD-like receptor signaling pathway
    103731654
   04622 RIG-I-like receptor signaling pathway
    103731654
   04623 Cytosolic DNA-sensing pathway
    103731654
   04650 Natural killer cell mediated cytotoxicity
    103731654
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103731654
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103731654
   05161 Hepatitis B
    103731654
   05160 Hepatitis C
    103731654
   05171 Coronavirus disease - COVID-19
    103731654
   05164 Influenza A
    103731654
   05162 Measles
    103731654
   05168 Herpes simplex virus 1 infection
    103731654
   05163 Human cytomegalovirus infection
    103731654
   05167 Kaposi sarcoma-associated herpesvirus infection
    103731654
   05169 Epstein-Barr virus infection
    103731654
   05165 Human papillomavirus infection
    103731654
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103731654
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103731654
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103731654
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103731654
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interferons
   103731654
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103731654
NCBI-ProteinID: XP_008828253
LinkDB
Position
Un
AA seq 191 aa
MTRPCAFLMVLMVVSYWTIRCLACDLPHTHNLQYRRTLLLLEKMRRISPLSCLKDRNDFE
FPWEEFHGKQIQSAQTVAVLHELTQQILNLFGSKAASAAWETSLLGEFHTGLYQLLNALQ
ACQIQQVEVLEPSLRQEDSLVAVRKYFHRITTYLREKKHSPCAWEVVRAEIMRSFFFSRN
FLGRLRRMSEA
NT seq 576 nt   +upstreamnt  +downstreamnt
atgaccaggccctgtgctttcctaatggtcctaatggtggtgagctactggacaattcgc
tgtctagcctgtgatctgcctcacacacataacctgcagtataggaggactttgttgctc
ctggagaaaatgaggagaatctcccctctctcctgcctaaaagacagaaatgactttgaa
tttccctgggaggagtttcacggtaagcagatccagagtgctcaaactgtcgctgtcctc
catgaactgacccagcagatcttgaacctcttcggctcgaaggccgcctctgctgcgtgg
gaaacaagcctcctaggagaattccacactggcctctatcagctactgaatgctctgcaa
gcctgtcagatacagcaggtggaggtactagagccttctctaaggcaggaggactcccta
gtggctgtgaggaaatacttccacaggatcactacctacctgagagagaagaaacacagt
ccttgtgcctgggaggtggtcagagcagaaatcatgagatccttctttttctcaagaaac
tttctgggaagactcagaagaatgagtgaggcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732546
Entry
103732546         CDS       T03372                                 

Definition
(RefSeq) interferon alpha-13-like
  KO
K05414  interferon alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04217  Necroptosis
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04623  Cytosolic DNA-sensing pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05320  Autoimmune thyroid disease
ngi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103732546
   04151 PI3K-Akt signaling pathway
    103732546
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103732546
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103732546
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103732546
   04621 NOD-like receptor signaling pathway
    103732546
   04622 RIG-I-like receptor signaling pathway
    103732546
   04623 Cytosolic DNA-sensing pathway
    103732546
   04650 Natural killer cell mediated cytotoxicity
    103732546
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103732546
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103732546
   05161 Hepatitis B
    103732546
   05160 Hepatitis C
    103732546
   05171 Coronavirus disease - COVID-19
    103732546
   05164 Influenza A
    103732546
   05162 Measles
    103732546
   05168 Herpes simplex virus 1 infection
    103732546
   05163 Human cytomegalovirus infection
    103732546
   05167 Kaposi sarcoma-associated herpesvirus infection
    103732546
   05169 Epstein-Barr virus infection
    103732546
   05165 Human papillomavirus infection
    103732546
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103732546
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103732546
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103732546
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103732546
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interferons
   103732546
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103732546
NCBI-ProteinID: XP_008829363
LinkDB
Position
Un
AA seq 191 aa
MTRPCAFLMVLMVVSYWTIHCLACDLPHTHNLQYRRTLLLLEKMRRISPLSCLKDRNDFE
FPWEEFHGKQIQSAQTVAVLHELTQQILNLFGSKDSSAAWETSLLEEFHTGLYQLLNALQ
ACQIQQVEVLEPSLRQEDSLVAVRKYFHRITTYLREKKHSPCAWEVVRAEIMRSFFFSRN
FLGRLRRMSEA
NT seq 576 nt   +upstreamnt  +downstreamnt
atgaccaggccctgtgctttcctgatggtcctaatggtggtgagctactggacaattcac
tgtctagcctgtgatctgcctcacacacataacctgcagtataggaggactttgttgctc
ctggaaaaaatgaggagaatctcccctctctcctgcctaaaagacagaaatgactttgaa
ttcccctgggaggagtttcatggtaagcagatccagagtgctcaaactgtcgctgtcctc
catgaactgacccagcagatcttgaacctcttcggctcgaaggactcctctgctgcgtgg
gagacaagcctcctagaagaattccacactggcctctatcagctactgaatgctctgcaa
gcctgtcagatacagcaggtggaggtactagagccttctctaaggcaggaggactcccta
gtggctgtgaggaaatacttccacaggatcactacctacctgagagagaagaaacacagt
ccttgtgcctgggaggtggtcagagcagaaatcatgagatccttctttttctcaagaaac
tttctgggaagactcagaagaatgagtgaggcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734248
Entry
103734248         CDS       T03372                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04622  RIG-I-like receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103734248
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103734248
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    103734248
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103734248
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interferons
   103734248
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103734248
NCBI-ProteinID: XP_008831353
LinkDB
Position
Un
AA seq 194 aa
MALLFPLLATLLACNYGPVGSLGCDLPRNSDLLTRKTFVLLGQMRRVSPFLCLKDRRNFQ
FLQELLDDRQIHRAQAVSVLHEMLQQIFNIFHTEHAAAAWNTPLLDELRMGLHQQLETLK
TCLIQVIREEDFSLAMEDQEVALRKYFRGIHLYLDEKSYSDCAWEIVRVETVRAFSSVAK
LQERLIKAGDLGSS
NT seq 585 nt   +upstreamnt  +downstreamnt
atggccctcctgttccctctcctggccaccctgttggcgtgcaattatggccctgttgga
tctctgggctgtgacctgcctcggaactctgacttgcttaccaggaagacctttgtactc
ttaggccaaatgaggagagtttcccctttcttgtgtctgaaggacagaaggaacttccaa
ttcctccaagagctactggatgacaggcagatccacagggcccaggctgtctctgttctc
catgagatgttacagcagatcttcaacatcttccacacagagcatgctgctgctgcctgg
aacacacccctcctggatgaactccgcatgggacttcatcagcagttggagaccctgaaa
acctgcttaattcaggtgataagagaggaagacttttccctggcaatggaggatcaggaa
gtggccttaaggaagtacttccggggaatccatctctaccttgatgagaagagctacagt
gactgtgcctgggagatagtgagagtggaaactgtgagagccttctcctctgtagcaaag
ctgcaagaaagattaattaaggctggagacctgggatcctcttga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736148
Entry
103736148         CDS       T03372                                 

Definition
(RefSeq) interferon alpha-12-like
  KO
K05414  interferon alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04217  Necroptosis
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04623  Cytosolic DNA-sensing pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05320  Autoimmune thyroid disease
ngi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103736148
   04151 PI3K-Akt signaling pathway
    103736148
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103736148
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103736148
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103736148
   04621 NOD-like receptor signaling pathway
    103736148
   04622 RIG-I-like receptor signaling pathway
    103736148
   04623 Cytosolic DNA-sensing pathway
    103736148
   04650 Natural killer cell mediated cytotoxicity
    103736148
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103736148
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103736148
   05161 Hepatitis B
    103736148
   05160 Hepatitis C
    103736148
   05171 Coronavirus disease - COVID-19
    103736148
   05164 Influenza A
    103736148
   05162 Measles
    103736148
   05168 Herpes simplex virus 1 infection
    103736148
   05163 Human cytomegalovirus infection
    103736148
   05167 Kaposi sarcoma-associated herpesvirus infection
    103736148
   05169 Epstein-Barr virus infection
    103736148
   05165 Human papillomavirus infection
    103736148
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103736148
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103736148
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103736148
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103736148
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interferons
   103736148
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 103736148
NCBI-ProteinID: XP_008833827
LinkDB
Position
Un
AA seq 191 aa
MARSCVFLIALWVMSHWTTCSLGCDMPQMHNLGYRRALVLLGKMRRLSPLSCLKDRNDFE
FPREEFHGKQIQKGEALSVLHELTQQILNLFSSKDSSAALETSLLEEFCTGLYQLLNVLQ
ACQMQQVEVLEPSLRQEDSLVAVRKYFHRITAYLREKKHSPCAWEVVRAEIMRSFSSSAN
LLGRLRRMSEA
NT seq 576 nt   +upstreamnt  +downstreamnt
atggccaggtcctgtgttttcctgatagctctgtgggtaatgagccactggacaacctgc
tctctaggctgtgacatgcctcagatgcataacctgggctacaggagggccttggtactc
ctggggaaaatgaggagactctctcctctctcctgcctaaaagacagaaatgactttgaa
ttcccccgagaggaatttcatggcaagcagatccagaagggtgaagccctctctgtcctc
catgagctgactcagcagatcttgaacctcttcagttctaaggactcctctgcagctttg
gagacaagcctcctagaggaattctgcactggcctctatcagctgctgaatgtcctgcaa
gcctgtcagatgcagcaggtggaggtactagagccttccctgaggcaggaggactcccta
gtggctgtgagaaaatacttccacaggatcactgcctacctgagagagaagaaacacagc
ccttgtgcctgggaggtggtcagagcagaaatcatgagatccttctcttcctcagccaac
ttactgggaagactgagaagaatgagtgaggcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740454
Entry
103740454         CDS       T03372                                 

Gene name
Lif
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04630  JAK-STAT signaling pathway
ngi04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103740454 (Lif)
   04668 TNF signaling pathway
    103740454 (Lif)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103740454 (Lif)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103740454 (Lif)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103740454 (Lif)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103740454 (Lif)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 103740454
NCBI-ProteinID: XP_008839292
LinkDB
Position
Un
AA seq 202 aa
MKVLAAGVVPLLLVLHWKHGAASPLPITPVNATCATRHPCHGNLMNQIKNQLAQLNGSAN
ALFISYYTAQGEPFPNNLDKLCGPNMTDFPPFHANGTEKAKLVELYRLVAYLGASLGNVT
RDQKILNPNALSLHSKLNATTDTMRGLLSNVLCRLCNKYHVGHVDVTYGPDTAGKDAFQK
KKLGCQLLGTYKQVISLVAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaggtcttggccgcaggagttgtgcccttgctgctggttctgcactggaaacacggg
gcagcgagcccccttcccatcacccctgttaatgctacctgtgccacacgccacccatgt
catggcaacctcatgaatcagatcaagaaccaattggctcagctcaatggcagtgccaat
gccctcttcatttcctattatacagctcagggggagccattccccaacaacctcgacaag
ctgtgtggacccaacatgacggacttcccacccttccatgccaatggcacagaaaaggcc
aagctggtggagctgtatcgtttggtcgcatacctgggtgcctccctgggcaacgtcacc
cgggatcagaagatcctgaaccccaatgccctgagcctccacagcaagctcaatgccacc
acagacaccatgcggggcctcctcagcaatgtgctttgtcgcctgtgcaacaagtaccat
gtgggccacgtggacgtgacctatggccctgacaccgcaggcaaggatgctttccaaaag
aaaaagctgggctgccagctcctggggacgtacaagcaagtcattagcctggtggcccag
gccttctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740483
Entry
103740483         CDS       T03372                                 

Gene name
Osm
Definition
(RefSeq) oncostatin M
  KO
K05418  oncostatin M
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103740483 (Osm)
   04151 PI3K-Akt signaling pathway
    103740483 (Osm)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103740483 (Osm)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103740483 (Osm)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103740483 (Osm)
SSDB
Motif
Pfam: LIF_OSM Apolipo_F
Other DBs
NCBI-GeneID: 103740483
NCBI-ProteinID: XP_008839346
LinkDB
Position
Un
AA seq 239 aa
MQAQFPQKTLLSLVLSLLLLSAALAMPGCSSSYQMLLSQLQRLANDTEDPRSLAEPYMHH
QSLNTTTLRKSCTEHPAAFPSEDALRALSKLDFLHTIDTMLGQVQHRVEALKQQFVRTQN
FPQLENAEYKIRGIRNNVYCMSWLLRRSQKTLEPTQTSSRALLSPAPTSDTFQAKLDSCR
FLWGYHSFMGSVGRVFSEWGDSLSRSRRHSPRRALHKRAHGFRHSRSSQRPMPRSQLPW
NT seq 720 nt   +upstreamnt  +downstreamnt
atgcaggcacagttcccacagaagactctgctcagtctagtcctcagcctcctgctcctg
agcgcggcattggctatgcctggctgttccagctcttaccagatgctcctcagccagctg
cagagactggcaaacgacacagaggaccccagatcactcgcagagccatatatgcaccac
caaagcttgaacaccacaactctgaggaagtcctgcacagagcaccctgcagccttccca
agtgaggatgccctgcgggcactgagcaagctggacttcttgcacaccatcgacaccatg
ctgggccaagtccagcaccgagtggaggctttaaagcagcaatttgtgaggactcagaac
ttcccgcagctggagaatgctgagtacaagatccggggcatccgaaacaatgtgtactgc
atgagctggctgctccgcagatcccagaagacacttgaacccacacagacaagctctagg
gccttgttatcccctgccccaacatcagacacctttcaggccaagctggacagctgccgc
ttcctgtgggggtaccactccttcatgggctcagtggggcgggttttcagtgagtggggg
gacagtttgagccgcagccggagacacagcccacgacgggccctgcacaagagagctcac
gggttcagacactccaggagcagccagaggcccatgcccaggagtcagcttccctggtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740849
Entry
103740849         CDS       T03372                                 

Gene name
Il6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01523  Antifolate resistance
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04218  Cellular senescence
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04623  Cytosolic DNA-sensing pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04657  IL-17 signaling pathway
ngi04659  Th17 cell differentiation
ngi04668  TNF signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi05010  Alzheimer disease
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05132  Salmonella infection
ngi05133  Pertussis
ngi05134  Legionellosis
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05143  African trypanosomiasis
ngi05144  Malaria
ngi05146  Amoebiasis
ngi05152  Tuberculosis
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05321  Inflammatory bowel disease
ngi05323  Rheumatoid arthritis
ngi05332  Graft-versus-host disease
ngi05410  Hypertrophic cardiomyopathy
ngi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103740849 (Il6)
   04668 TNF signaling pathway
    103740849 (Il6)
   04066 HIF-1 signaling pathway
    103740849 (Il6)
   04068 FoxO signaling pathway
    103740849 (Il6)
   04151 PI3K-Akt signaling pathway
    103740849 (Il6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103740849 (Il6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103740849 (Il6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103740849 (Il6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103740849 (Il6)
   04620 Toll-like receptor signaling pathway
    103740849 (Il6)
   04621 NOD-like receptor signaling pathway
    103740849 (Il6)
   04623 Cytosolic DNA-sensing pathway
    103740849 (Il6)
   04625 C-type lectin receptor signaling pathway
    103740849 (Il6)
   04659 Th17 cell differentiation
    103740849 (Il6)
   04657 IL-17 signaling pathway
    103740849 (Il6)
   04672 Intestinal immune network for IgA production
    103740849 (Il6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103740849 (Il6)
   05202 Transcriptional misregulation in cancer
    103740849 (Il6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103740849 (Il6)
   05161 Hepatitis B
    103740849 (Il6)
   05171 Coronavirus disease - COVID-19
    103740849 (Il6)
   05164 Influenza A
    103740849 (Il6)
   05162 Measles
    103740849 (Il6)
   05168 Herpes simplex virus 1 infection
    103740849 (Il6)
   05163 Human cytomegalovirus infection
    103740849 (Il6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103740849 (Il6)
   05169 Epstein-Barr virus infection
    103740849 (Il6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103740849 (Il6)
   05135 Yersinia infection
    103740849 (Il6)
   05133 Pertussis
    103740849 (Il6)
   05134 Legionellosis
    103740849 (Il6)
   05152 Tuberculosis
    103740849 (Il6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103740849 (Il6)
   05144 Malaria
    103740849 (Il6)
   05142 Chagas disease
    103740849 (Il6)
   05143 African trypanosomiasis
    103740849 (Il6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103740849 (Il6)
   05321 Inflammatory bowel disease
    103740849 (Il6)
   05332 Graft-versus-host disease
    103740849 (Il6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103740849 (Il6)
   05020 Prion disease
    103740849 (Il6)
   05022 Pathways of neurodegeneration - multiple diseases
    103740849 (Il6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103740849 (Il6)
   05410 Hypertrophic cardiomyopathy
    103740849 (Il6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103740849 (Il6)
   04931 Insulin resistance
    103740849 (Il6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103740849 (Il6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103740849 (Il6)
   01523 Antifolate resistance
    103740849 (Il6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103740849 (Il6)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103740849 (Il6)
SSDB
Motif
Pfam: IL6 IL23 IL11 GCSF
Other DBs
NCBI-GeneID: 103740849
NCBI-ProteinID: XP_008839768
LinkDB
Position
Un
AA seq 212 aa
MKFLSTRTLHPLAFLGLLLVTATAFPASQVREEASTDDTTPNRPAYTTPQKMEGLISYVI
GEISEIRTELCDHDENCLNNDEAFLANNLEPPRLTIKDGCFQTGYNRETCLLKVTSGLLE
YQVYLEYIQGKLKDTRQEKVKNVQANVKTLIRILKQEIKNLSKVIFPSPTANASLLEKLD
TQNEWHKTMAIHFILRQLENFLTTTIRAIREN
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaagttcctctccacaagaaccctccatcctcttgccttcttggggctgctcctggtg
acggccactgccttccccgcctcgcaagtccgggaagaagctagcacagatgataccacc
cccaacagaccagcatataccactccacaaaagatggaaggcctgatttcatatgtcatc
ggggaaatctcggaaataagaactgagttgtgtgatcatgatgagaattgcttgaacaat
gacgaggcctttttagcaaacaatctggagcctccaaggctaacaataaaagatggatgt
ttccaaactggatacaatcgggaaacttgcctgttgaaagtcacctctggtcttctggag
taccaggtctacctggagtacatccagggcaagttgaaagatactcggcaagaaaaagtc
aaaaacgtgcaggccaatgtcaagaccctaattcggatcttgaaacaagagataaaaaat
ctgagtaaagtcatcttccctagcccaactgccaatgccagcctgctggaaaagctggat
acacagaacgagtggcacaagaccatggccatccacttcatcctgcggcaacttgagaat
ttcctaacgaccaccataagggctattcgggaaaactaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742384
Entry
103742384         CDS       T03372                                 

Gene name
Il15
Definition
(RefSeq) interleukin 15
  KO
K05433  interleukin 15
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04668  TNF signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103742384 (Il15)
   04668 TNF signaling pathway
    103742384 (Il15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103742384 (Il15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    103742384 (Il15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103742384 (Il15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103742384 (Il15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103742384 (Il15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103742384 (Il15)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103742384 (Il15)
SSDB
Motif
Pfam: IL15 DUF5321
Other DBs
NCBI-GeneID: 103742384
NCBI-ProteinID: XP_008841663
LinkDB
Position
Un
AA seq 162 aa
MKILKPYMRTTSIPCYLCFLLNSHFLTEAGIHIFIWGCLGAGLPKTEANWNDVIKDLRKI
EVLIQSIHIDATLYTESDFHPSCKVTTMKCFLLELRVILHESSDVYINETVRNMIILANS
SLSSNGNITESGCKECEELEEKNITEFIQSFVRIVQMFIHPS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaaaattttgaaaccatatatgagaactacttccatcccgtgctacttgtgtttcctt
ctgaacagtcattttttaacggaggctggcattcacatcttcatttggggctgcctcggt
gcaggtcttcctaaaacagaggccaattggaatgatgtaataaaagatctgagaaaaatt
gaagtgcttattcagtctatccacattgatgctactttatacactgagagtgattttcat
cccagttgcaaagtaacaacgatgaagtgctttctcctggagctacgagttattttacat
gagtccagtgatgtatacattaatgaaacagtaagaaatatgatcatcctagcaaacagc
agtctgtcttctaatgggaatataacagaatctggatgcaaagaatgtgaggaactggaa
gaaaaaaacattacagaatttattcagagttttgtgcgtattgtacaaatgttcatccac
ccttcttga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743951
Entry
103743951         CDS       T03372                                 

Gene name
Ifnb1
Definition
(RefSeq) interferon beta 1
  KO
K05415  interferon beta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04217  Necroptosis
ngi04380  Osteoclast differentiation
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04623  Cytosolic DNA-sensing pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04668  TNF signaling pathway
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103743951 (Ifnb1)
   04668 TNF signaling pathway
    103743951 (Ifnb1)
   04151 PI3K-Akt signaling pathway
    103743951 (Ifnb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103743951 (Ifnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103743951 (Ifnb1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103743951 (Ifnb1)
   04621 NOD-like receptor signaling pathway
    103743951 (Ifnb1)
   04622 RIG-I-like receptor signaling pathway
    103743951 (Ifnb1)
   04623 Cytosolic DNA-sensing pathway
    103743951 (Ifnb1)
   04650 Natural killer cell mediated cytotoxicity
    103743951 (Ifnb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103743951 (Ifnb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103743951 (Ifnb1)
   05161 Hepatitis B
    103743951 (Ifnb1)
   05160 Hepatitis C
    103743951 (Ifnb1)
   05171 Coronavirus disease - COVID-19
    103743951 (Ifnb1)
   05164 Influenza A
    103743951 (Ifnb1)
   05162 Measles
    103743951 (Ifnb1)
   05168 Herpes simplex virus 1 infection
    103743951 (Ifnb1)
   05163 Human cytomegalovirus infection
    103743951 (Ifnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103743951 (Ifnb1)
   05169 Epstein-Barr virus infection
    103743951 (Ifnb1)
   05165 Human papillomavirus infection
    103743951 (Ifnb1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103743951 (Ifnb1)
   05152 Tuberculosis
    103743951 (Ifnb1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103743951 (Ifnb1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103743951 (Ifnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103743951 (Ifnb1)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interferons
   103743951 (Ifnb1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103743951
NCBI-ProteinID: XP_008843743
LinkDB
Position
Un
AA seq 186 aa
MTNGCILQTLLLLCFSTTALSISYKALRLYQSSGSVTCQELLLQLNVRLRPCLEDRINFK
LPEKIKHQQQFKKKDAAFLIHEMLQNIFSVFTNDFSSTGWNKTIVENLFGELHKQMDRLE
TILKEKPEESLAWRNSMAILHLKSYYRRLQRYLKDKEYSSCAWMVVRAEIMRNFPIISKL
TDCFQN
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaccaacgggtgtatcctccaaaccttgctccttctgtgcttttctaccacagccctc
tccatcagctacaaggcgcttcgactctatcaaagcagcggcagtgtgacatgccaggag
ctcctgttacagctgaatgtaaggctaaggccctgccttgaggacaggattaactttaag
ctccctgagaaaatcaagcaccaacagcagttcaagaagaaggatgctgccttcctcatc
catgagatgctccagaatatcttctctgtctttacaaatgatttctccagcactgggtgg
aataagaccattgttgagaacctctttggtgaactccataaacagatggaccgtctggag
acaatcctgaaggaaaaaccagaagagagcttagcctggagaaactccatggccattctc
catttgaagagctattatcggagactgcaaaggtacctgaaagacaaggagtacagcagc
tgtgcctggatggtggtccgagcagaaatcatgaggaactttcccatcattagcaaactt
actgattgctttcagaactga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744811
Entry
103744811         CDS       T03372                                 

Gene name
Il11
Definition
(RefSeq) interleukin 11
  KO
K05417  interleukin 11
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103744811 (Il11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103744811 (Il11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103744811 (Il11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    103744811 (Il11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103744811 (Il11)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103744811 (Il11)
SSDB
Motif
Pfam: IL11
Other DBs
NCBI-GeneID: 103744811
NCBI-ProteinID: XP_008844882
LinkDB
Position
Un
AA seq 199 aa
MNCVCGLVLVVLSLWPDRAVAPGPPSGYPRASPDPRAELDSAVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGTLGTLQLPGVLTRLRVDLLSYLRHVQWLRRAGGPSLK
TLEPELGALQARLDRLLRRLQLLMSRLALPQAPSEHPVAPLGAPVSAWGSIRAAHAILGG
LHLTLDWAVRGLMLLKTRL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaactgtgtttgtggcctggtcctggtggtgctgagcctctggccagatagagctgtt
gcccctggaccgccatctggctaccctcgagcctctccagatcctcgggcagaactggac
agtgcagtacttctaacccgctccctcttggcagacactcggcaactggctgcacagctg
agagacaaattcccagcagacggggaccacaacctggactccctacccaccttggccatg
agtgctgggacattgggaaccctgcagcttccaggtgtactgacaaggcttcgagtagac
ctactctcctaccttcggcatgtacagtggctgcgtcgagcaggtggtccttcccttaag
accttggaaccagaactgggtgccctgcaagcccggctggaccggctattgcgccgtctg
cagctcttgatgtctcgtctggccctgccccaggcaccctcagaacatccggtggccccc
ctgggtgcccctgtctcagcctggggaagcatccgggcagctcatgccatcttaggaggg
ttgcacctgaccttggactgggctgttcgggggctgatgctgttgaagactcggctgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103745073
Entry
103745073         CDS       T03372                                 

Gene name
Il22
Definition
(RefSeq) interleukin 22
  KO
K05445  interleukin 22
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04659  Th17 cell differentiation
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103745073 (Il22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103745073 (Il22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103745073 (Il22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    103745073 (Il22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103745073 (Il22)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103745073 (Il22)
SSDB
Motif
Pfam: IL22 IL10 FlaC_arch
Other DBs
NCBI-GeneID: 103745073
NCBI-ProteinID: XP_008845184
LinkDB
Position
Un
AA seq 179 aa
MAPLQKPGSFPLLGALATGCLLLIGLWTQEGSALPITSHCKLDRSNFQQPYITNRTFMLA
QEASLADNNTDVRLIGGKLFEGVKVKEHCYLMKQVLNFTLEEVLLPQSDRFQPYMQEVVS
FLTKLSSKLSLCRIEGDDQHIQKNVQELKDTVKKLGESGEIKVIGEMDLLFMSLGNTCI
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcccctctgcagaagcctgggagctttcccctcctgggggctttggccactggctgc
ctgcttctcattggcctgtggacacaggagggatcagcgctgcccatcacctcccactgc
aagcttgacaggtctaacttccagcagccctacatcaccaatcgtaccttcatgctggcc
caggaggctagccttgcagacaacaacacagatgtccgtctcattggagggaagctgttt
gagggagtcaaagtaaaagagcactgctatctgatgaagcaggtgctcaactttaccctt
gaagaagtgctgctcccccagtcagacagattccagccctacatgcaagaggtggtgtcc
ttcctgaccaagctcagcagcaagctcagcctatgtcgcattgagggagatgaccagcat
atccagaagaacgttcaagagctgaaggacacagtcaaaaagcttggagagagtggagag
atcaaagtaattggggaaatggatctgctcttcatgtccctaggaaatacctgcatctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103745085
Entry
103745085         CDS       T03372                                 

Gene name
Ifng
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi03050  Proteasome
ngi04060  Cytokine-cytokine receptor interaction
ngi04066  HIF-1 signaling pathway
ngi04217  Necroptosis
ngi04350  TGF-beta signaling pathway
ngi04380  Osteoclast differentiation
ngi04612  Antigen processing and presentation
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04657  IL-17 signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04940  Type I diabetes mellitus
ngi05140  Leishmaniasis
ngi05142  Chagas disease
ngi05143  African trypanosomiasis
ngi05144  Malaria
ngi05145  Toxoplasmosis
ngi05146  Amoebiasis
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05164  Influenza A
ngi05168  Herpes simplex virus 1 infection
ngi05200  Pathways in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05321  Inflammatory bowel disease
ngi05322  Systemic lupus erythematosus
ngi05323  Rheumatoid arthritis
ngi05330  Allograft rejection
ngi05332  Graft-versus-host disease
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    103745085 (Ifng)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103745085 (Ifng)
   04630 JAK-STAT signaling pathway
    103745085 (Ifng)
   04066 HIF-1 signaling pathway
    103745085 (Ifng)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103745085 (Ifng)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103745085 (Ifng)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103745085 (Ifng)
   04612 Antigen processing and presentation
    103745085 (Ifng)
   04660 T cell receptor signaling pathway
    103745085 (Ifng)
   04658 Th1 and Th2 cell differentiation
    103745085 (Ifng)
   04659 Th17 cell differentiation
    103745085 (Ifng)
   04657 IL-17 signaling pathway
    103745085 (Ifng)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103745085 (Ifng)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103745085 (Ifng)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103745085 (Ifng)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103745085 (Ifng)
   05164 Influenza A
    103745085 (Ifng)
   05168 Herpes simplex virus 1 infection
    103745085 (Ifng)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103745085 (Ifng)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103745085 (Ifng)
   05144 Malaria
    103745085 (Ifng)
   05145 Toxoplasmosis
    103745085 (Ifng)
   05140 Leishmaniasis
    103745085 (Ifng)
   05142 Chagas disease
    103745085 (Ifng)
   05143 African trypanosomiasis
    103745085 (Ifng)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    103745085 (Ifng)
   05323 Rheumatoid arthritis
    103745085 (Ifng)
   05321 Inflammatory bowel disease
    103745085 (Ifng)
   05330 Allograft rejection
    103745085 (Ifng)
   05332 Graft-versus-host disease
    103745085 (Ifng)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103745085 (Ifng)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103745085 (Ifng)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ngi03051]
    103745085 (Ifng)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103745085 (Ifng)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103745085 (Ifng)
Proteasome [BR:ngi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103745085 (Ifng)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interferons
   103745085 (Ifng)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Cytokines
   103745085 (Ifng)
SSDB
Motif
Pfam: IFN-gamma DUF4459
Other DBs
NCBI-GeneID: 103745085
NCBI-ProteinID: XP_008845202
LinkDB
Position
Un
AA seq 174 aa
MNAASYIFTLQLCFMLGISSCHCQTNFFEEVENLKEYFNASSPDVADGEPLFLDVLRKWN
EESDKKIIHSQIVSFYFKLLDTLKDNRMIQTSLATVKETLFIKFFNSSIDKRNDFIKLTQ
IPVNNLQVQRKAVSELIKVMNELSPRPILRKRKRSRCCFGTANRPNKNHPASAI
NT seq 525 nt   +upstreamnt  +downstreamnt
atgaatgctgcaagttacatcttcactctccagctctgcttcatgttgggtatttctagc
tgtcactgccagaccaacttctttgaagaagtagaaaatctaaaggagtattttaatgca
agcagcccagatgtcgcagatggagagcccctcttcttagatgttttgagaaaatggaat
gaggagagtgacaaaaaaatcatccatagccagatcgtctccttctacttcaaactctta
gacaccttgaaagacaacaggatgatccagacgagcttggccactgtcaaggaaaccctg
tttattaaattcttcaacagcagcattgacaaacgaaacgacttcataaagctgactcag
attccggtaaataacctgcaggtccaacgcaaagctgtcagtgaactcatcaaagtgatg
aatgagctgtcaccaagacctatcctaaggaagcggaaaaggagtcgatgctgttttggg
accgcaaatcgtccaaataagaaccatcctgccagcgctatttga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103745345
Entry
103745345         CDS       T03372                                 

Gene name
Il12a
Definition
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04620  Toll-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04940  Type I diabetes mellitus
ngi05133  Pertussis
ngi05134  Legionellosis
ngi05140  Leishmaniasis
ngi05142  Chagas disease
ngi05143  African trypanosomiasis
ngi05144  Malaria
ngi05145  Toxoplasmosis
ngi05146  Amoebiasis
ngi05152  Tuberculosis
ngi05162  Measles
ngi05164  Influenza A
ngi05168  Herpes simplex virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05321  Inflammatory bowel disease
ngi05330  Allograft rejection
ngi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103745345 (Il12a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103745345 (Il12a)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103745345 (Il12a)
   04622 RIG-I-like receptor signaling pathway
    103745345 (Il12a)
   04625 C-type lectin receptor signaling pathway
    103745345 (Il12a)
   04658 Th1 and Th2 cell differentiation
    103745345 (Il12a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103745345 (Il12a)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103745345 (Il12a)
   05164 Influenza A
    103745345 (Il12a)
   05162 Measles
    103745345 (Il12a)
   05168 Herpes simplex virus 1 infection
    103745345 (Il12a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    103745345 (Il12a)
   05134 Legionellosis
    103745345 (Il12a)
   05152 Tuberculosis
    103745345 (Il12a)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103745345 (Il12a)
   05144 Malaria
    103745345 (Il12a)
   05145 Toxoplasmosis
    103745345 (Il12a)
   05140 Leishmaniasis
    103745345 (Il12a)
   05142 Chagas disease
    103745345 (Il12a)
   05143 African trypanosomiasis
    103745345 (Il12a)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103745345 (Il12a)
   05330 Allograft rejection
    103745345 (Il12a)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103745345 (Il12a)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103745345 (Il12a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103745345 (Il12a)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103745345 (Il12a)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103745345 (Il12a)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Cytokines
   103745345 (Il12a)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 103745345
NCBI-ProteinID: XP_008845496
LinkDB
Position
Un
AA seq 249 aa
MCPPGSVSQPPXTCCAHGSSPAAHPESKQHRPSMSPSRRLLLVTLVLLNHLSLARNLPTP
VSRSAQCFNHSQKLLRTVNHMLGKARQILKHYSCTAEEIDHEDITKDKTSTLQACLPLEL
VKNESCLASRETSFKTTGSCLGSGKTSLMMTPCLSSIYEDLKMYQMEFKAMNTELVKDNP
RQIILDENMLAAIDEMMRALNFNDETLPQNPALEELDSYKLKMKLCILLHAFSIRTVTIS
RVMSYLNSS
NT seq 750 nt   +upstreamnt  +downstreamnt
atgtgtcctccggggtcagtatcccaaccgcctnncacctgctgcgcccacggctcgagt
ccagcagcccacccagagtccaagcagcaccggcccagcatgagtccctcacgccgcctt
cttttggtcacccttgtcctgttgaaccacctcagtttggccaggaacctccccacacca
gtgtccagatcagcccagtgttttaaccactcccaaaaattgctgaggactgtcaaccac
atgctggggaaggccagacaaattctaaaacactattcttgcactgctgaagagattgat
catgaagacatcacaaaagacaagaccagcacactacaggcctgtttaccactggaacta
gtcaagaatgagagttgcctggcttccagagagacttcttttaaaactactggtagctgt
ctgggctctgggaagacttctttgatgatgaccccgtgccttagcagtatctatgaggac
ttgaagatgtaccagatggagttcaaggccatgaatacagagcttgtaaaggataatcca
aggcagatcatcctggatgagaacatgctagcagctattgacgagatgatgcgggctctg
aatttcaatgatgagactctgcctcagaatcctgccctggaagaactggattcttataaa
cttaaaatgaagctctgtatcctgcttcatgctttcagtatccgaactgtgactatcagt
agagtgatgagctatctgaattcctcctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746144
Entry
103746144         CDS       T03372                                 

Definition
(RefSeq) interferon beta-like
  KO
K05415  interferon beta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04217  Necroptosis
ngi04380  Osteoclast differentiation
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04623  Cytosolic DNA-sensing pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04668  TNF signaling pathway
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103746144
   04668 TNF signaling pathway
    103746144
   04151 PI3K-Akt signaling pathway
    103746144
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103746144
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103746144
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103746144
   04621 NOD-like receptor signaling pathway
    103746144
   04622 RIG-I-like receptor signaling pathway
    103746144
   04623 Cytosolic DNA-sensing pathway
    103746144
   04650 Natural killer cell mediated cytotoxicity
    103746144
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103746144
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103746144
   05161 Hepatitis B
    103746144
   05160 Hepatitis C
    103746144
   05171 Coronavirus disease - COVID-19
    103746144
   05164 Influenza A
    103746144
   05162 Measles
    103746144
   05168 Herpes simplex virus 1 infection
    103746144
   05163 Human cytomegalovirus infection
    103746144
   05167 Kaposi sarcoma-associated herpesvirus infection
    103746144
   05169 Epstein-Barr virus infection
    103746144
   05165 Human papillomavirus infection
    103746144
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103746144
   05152 Tuberculosis
    103746144
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103746144
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103746144
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103746144
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interferons
   103746144
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103746144
NCBI-ProteinID: XP_008846481
LinkDB
Position
Un
AA seq 186 aa
MTNGCILQTLLLLCFSTTALSISYKALRLYQSSGSVTCQELLLQLNIRPCLEDRINFKLP
EKIKHQQQFKKKDAAFLIHEMLQNIFSVFTNDFSSTGTGWNKTIVENLFGELHKQMDRLE
TILKEKPEESLAWRNSMAILHLKSYYRRLQRYLKDKEYSSCAWMVVRAEIMRNFPIISKL
TDCFQN
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaccaacgggtgtatcctccaaaccttgctccttctgtgcttttctaccacagccctc
tccatcagctacaaggcgcttcgactctatcaaagcagcggcagtgtgacatgccaggag
ctcctgttacagctgaatataaggccctgccttgaggacaggattaactttaagctccct
gagaaaattaagcaccaacagcagttcaagaagaaggatgctgccttcctcatccatgag
atgctccagaatatcttctctgtctttacaaatgatttctccagcactggcactgggtgg
aataagaccattgttgagaacctctttggtgaactccataaacagatggaccgtctggag
acaatcctgaaggaaaaaccagaagagagcttagcctggagaaactccatggccattctc
catttgaagagctattatcggagactgcaaaggtacctgaaagacaaggagtacagcagc
tgtgcctggatggtggtccgagcagaaatcatgaggaactttcccatcattagcaaactt
actgattgctttcagaactga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746524
Entry
103746524         CDS       T03372                                 

Gene name
Il23a
Definition
(RefSeq) interleukin 23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04659  Th17 cell differentiation
ngi05133  Pertussis
ngi05152  Tuberculosis
ngi05200  Pathways in cancer
ngi05321  Inflammatory bowel disease
ngi05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103746524 (Il23a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103746524 (Il23a)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103746524 (Il23a)
   04659 Th17 cell differentiation
    103746524 (Il23a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746524 (Il23a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    103746524 (Il23a)
   05152 Tuberculosis
    103746524 (Il23a)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103746524 (Il23a)
   05321 Inflammatory bowel disease
    103746524 (Il23a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103746524 (Il23a)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103746524 (Il23a)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 103746524
NCBI-ProteinID: XP_008846963
LinkDB
Position
Un
AA seq 195 aa
MQGCRAVMLLLLLSWTVQGLAMPRSNSPDWAQCQQLSRKLCTLAWSAHLPVGHMDLLREE
GEETTNDVPYIQCEDGCDPEGLKDNSQFCLQRIHQGLVFYKQLLDSDIFTEEPSLLPDGP
VGQLHTSLQGLSQLLQPKGHHWETQQMPSLSPSQPWQRPLLRFKILRSLQSFVAVAARVF
AHGATTLTEPLMPAA
NT seq 588 nt   +upstreamnt  +downstreamnt
atgcagggttgcagagctgtgatgctgctattgctgctgtcctggactgtgcagggcctg
gccatgcctagaagcaacagtcctgactgggctcaatgccaacagctttctcggaagctc
tgcacactggcctggagtgcacatctgccagtgggacatatggacctactaagagaagag
ggagaagagactacaaatgatgtcccctatatccagtgtgaagatggctgtgatcccgaa
ggacttaaggacaatagtcagttctgcttgcaaaggattcaccaaggtctggttttttat
aagcagctgctggactcagacatcttcacagaggaaccttctctactccctgatggccct
gtgggccagcttcatacctccctacagggcctcagtcaactcctccagcccaaaggtcac
cattgggagactcagcagatgcccagcctaagtcccagtcaaccatggcagcgccccctt
ctccgcttcaagatccttcgtagcctccaatcctttgtggctgtagctgcccgggtcttt
gctcatggagcaacaaccctgactgagcccctaatgccagcagcttaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746598
Entry
103746598         CDS       T03372                                 

Gene name
Il9
Definition
(RefSeq) interleukin 9
  KO
K05432  interleukin 9
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi05310  Asthma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103746598 (Il9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103746598 (Il9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    103746598 (Il9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103746598 (Il9)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103746598 (Il9)
SSDB
Motif
Pfam: PMSI1
Other DBs
NCBI-GeneID: 103746598
NCBI-ProteinID: XP_008847120
LinkDB
Position
Un
AA seq 144 aa
MFVATVLVSSLLFCSVQGQRCLTSMGILHVNSLINNLQKDPSSTCSCSTNATSCLCLPIP
PDNCTTPCFREGLSQLINVTQNTPLSVFFQRVRRTVEDLKNNKCSFFTCEQPCNQTTASN
TVTFLRSLLGTFQKEGMRERKGRI
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtttgtggccactgtccttgtctcttccctgctcttctgttctgtgcaaggccagaga
tgtctcaccagtatgggaatcctacatgtgaattcactcatcaacaacttgcagaaggac
ccatcctcaacatgcagctgcagtaccaatgcgaccagctgtttgtgtcttcccatccct
cctgacaattgtaccactccatgtttccgggagggactgtcacagttgatcaacgtcaca
cagaatacacccttgtcagtgttttttcagagagtcagaaggacggttgaggacctgaag
aacaacaaatgttcattctttacctgtgaacagccatgcaaccagaccacagcaagcaac
actgtgacatttctgaggagtctcctgggaactttccagaaggaagggatgagagaaagg
aaaggcagaatatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746653
Entry
103746653         CDS       T03372                                 

Definition
(RefSeq) interferon alpha-12-like
  KO
K05414  interferon alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04217  Necroptosis
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04623  Cytosolic DNA-sensing pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05320  Autoimmune thyroid disease
ngi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103746653
   04151 PI3K-Akt signaling pathway
    103746653
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103746653
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103746653
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103746653
   04621 NOD-like receptor signaling pathway
    103746653
   04622 RIG-I-like receptor signaling pathway
    103746653
   04623 Cytosolic DNA-sensing pathway
    103746653
   04650 Natural killer cell mediated cytotoxicity
    103746653
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746653
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103746653
   05161 Hepatitis B
    103746653
   05160 Hepatitis C
    103746653
   05171 Coronavirus disease - COVID-19
    103746653
   05164 Influenza A
    103746653
   05162 Measles
    103746653
   05168 Herpes simplex virus 1 infection
    103746653
   05163 Human cytomegalovirus infection
    103746653
   05167 Kaposi sarcoma-associated herpesvirus infection
    103746653
   05169 Epstein-Barr virus infection
    103746653
   05165 Human papillomavirus infection
    103746653
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103746653
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103746653
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103746653
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103746653
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interferons
   103746653
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103746653
NCBI-ProteinID: XP_017657644
LinkDB
Position
Un
AA seq 172 aa
MNRPHAFLMTLLVMSYWTTCSLGCDLLQMYNLGYRRPLILLGKMRRXSPLSCLKDRNDFE
FPQEEFHGNQIQKGHSPSILHELTQQILNLFSSNDSSAAWEASLLEEFCTGLYQLLNVLQ
ACQMQQVEALEPSLRQENSLVALRKYFHRITANLREKKHSPCAWEVVRAEIV
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaacaggccccatgctttcctgatgaccctgctggtgatgagctactggacaacatgc
tctctaggctgtgacctgcttcagatgtataacttggggtacagaaggcctttgattctc
ctggggaaaatgaggagannctcccctctctcctgcctgaaagatagaaatgactttgaa
ttcccccaggaagagtttcatggtaatcagatccagaaaggtcactccccctctatcctc
catgagctgacccagcagatcctgaacctcttcagttctaatgactcttctgctgcatgg
gaggcaagcctcctagaggaattctgcactggcctctatcagctgctcaatgtcctgcaa
gcctgtcagatgcagcaggtggaggcactagagccttccctgaggcaggagaactcccta
gtagctctgaggaaatacttccacaggatcactgccaacctgagagagaagaaacacagc
ccttgtgcctgggaggtggtcagagcagaaatcgtgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746654
Entry
103746654         CDS       T03372                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04217  Necroptosis
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04623  Cytosolic DNA-sensing pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05320  Autoimmune thyroid disease
ngi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103746654
   04151 PI3K-Akt signaling pathway
    103746654
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103746654
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103746654
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103746654
   04621 NOD-like receptor signaling pathway
    103746654
   04622 RIG-I-like receptor signaling pathway
    103746654
   04623 Cytosolic DNA-sensing pathway
    103746654
   04650 Natural killer cell mediated cytotoxicity
    103746654
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746654
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103746654
   05161 Hepatitis B
    103746654
   05160 Hepatitis C
    103746654
   05171 Coronavirus disease - COVID-19
    103746654
   05164 Influenza A
    103746654
   05162 Measles
    103746654
   05168 Herpes simplex virus 1 infection
    103746654
   05163 Human cytomegalovirus infection
    103746654
   05167 Kaposi sarcoma-associated herpesvirus infection
    103746654
   05169 Epstein-Barr virus infection
    103746654
   05165 Human papillomavirus infection
    103746654
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103746654
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103746654
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103746654
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103746654
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interferons
   103746654
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103746654
NCBI-ProteinID: XP_008847141
LinkDB
Position
Un
AA seq 191 aa
MTTPCAFLMVLMVVSYWTICCLACDLPHTHNLEYRRTLLLLEKMRRITPLSCLKDINYFE
FPWEEFHGKQIQRAQTVAVLHELTQQILNLFCSKDSSATWETSLLEELCIGLYQLLNALQ
ACQIQQVEALGPSLKQENTLVAVRKYFHRITTYLREKKHSPCAWELVRAEIMRSFSSSAN
FPGRLRRMSEA
NT seq 576 nt   +upstreamnt  +downstreamnt
atgaccacgccctgtgctttcctaatggtcctaatggtggtgagctactggacaatttgc
tgtctagcctgtgatctgcctcacacacataacctggagtataggaggactttgttgctc
ctggaaaaaatgaggagaatcacccctctgtcctgcctaaaagacataaattactttgaa
ttcccctgggaggagtttcatggtaagcagatccagagggctcaaactgtcgctgttctc
cacgaactgacccagcagatcttgaacctcttctgttctaaggactcctctgccacttgg
gagacaagcctcctagaggaattgtgcattggcctctatcagctgctgaatgctctacaa
gcctgtcagatacagcaggtggaggcactagggccttccctgaagcaggagaacacccta
gtggctgtaaggaagtacttccacaggatcaccacctacctgagggagaagaaacacagc
ccttgtgcctgggagttggtcagagcagaaatcatgagatccttctcttcctcagccaac
tttccgggaagactgaggagaatgagtgaggcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746950
Entry
103746950         CDS       T03372                                 

Gene name
Il21
Definition
(RefSeq) interleukin 21
  KO
K05434  interleukin 21
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04659  Th17 cell differentiation
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103746950 (Il21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103746950 (Il21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103746950 (Il21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    103746950 (Il21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103746950 (Il21)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103746950 (Il21)
SSDB
Motif
Pfam: IL15 Vta1 IL4 YmgB
Other DBs
NCBI-GeneID: 103746950
NCBI-ProteinID: XP_008847453
LinkDB
Position
Un
AA seq 146 aa
MERTLICLIVIFLGTTAHKSNPQRPDRLMIRLYHLIDNVEQLKNYVNDLDPELLPAPQDV
KGHCEQSAFSCFQKTKLKPTNAGNNKTIINDLIKQLKRKLPATKAGRRQKHRVTCPSCDS
YEKKPPKEFLERLKSLLQKMVHQHLS
NT seq 441 nt   +upstreamnt  +downstreamnt
atggagaggacccttatttgtctgatagtcatctttttggggacaacagcgcataaatca
aacccccaaaggccagatcgtctcatgattagactttatcaccttatagataatgttgaa
cagctgaaaaattatgtgaatgacttggatcctgaacttctgcctgctccacaagatgta
aagggacactgtgagcagtcagctttttcctgttttcagaagaccaaacttaagccaaca
aatgcaggaaacaataaaacaataatcaacgacttaattaaacagctgaagagaaagcta
cctgcaacaaaggcagggagaagacagaaacacagagttacatgtccttcctgtgattct
tatgagaaaaaaccacccaaagaattcctagaaagactgaaatcacttctccaaaagatg
gttcatcagcatctttcttag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746951
Entry
103746951         CDS       T03372                                 

Gene name
Il2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04151  PI3K-Akt signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi04940  Type I diabetes mellitus
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05162  Measles
ngi05166  Human T-cell leukemia virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05320  Autoimmune thyroid disease
ngi05321  Inflammatory bowel disease
ngi05330  Allograft rejection
ngi05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103746951 (Il2)
   04151 PI3K-Akt signaling pathway
    103746951 (Il2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103746951 (Il2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103746951 (Il2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103746951 (Il2)
   04660 T cell receptor signaling pathway
    103746951 (Il2)
   04658 Th1 and Th2 cell differentiation
    103746951 (Il2)
   04659 Th17 cell differentiation
    103746951 (Il2)
   04672 Intestinal immune network for IgA production
    103746951 (Il2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746951 (Il2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103746951 (Il2)
   05171 Coronavirus disease - COVID-19
    103746951 (Il2)
   05162 Measles
    103746951 (Il2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103746951 (Il2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103746951 (Il2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103746951 (Il2)
   05321 Inflammatory bowel disease
    103746951 (Il2)
   05330 Allograft rejection
    103746951 (Il2)
   05332 Graft-versus-host disease
    103746951 (Il2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103746951 (Il2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103746951 (Il2)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103746951 (Il2)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103746951 (Il2)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Cytokines
   103746951 (Il2)
SSDB
Motif
Pfam: IL2 Desmo_N
Other DBs
NCBI-GeneID: 103746951
NCBI-ProteinID: XP_008847454
LinkDB
Position
Un
AA seq 154 aa
MYNMQLVSCVALTLALLVSSAPTSSPTKETQQQLQQLLLDLQMLLRGTTNHKNSELSRML
TFKFYMPKKATELTHLQCLEEELQPLQEVLSLAQSKSFHLKDTREFISNIKVTILKLKGS
ENTFMCDYDDETATVVEFLSRWITFCQSLISTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaacatgcagcttgtgtcttgtgttgctctgactctcgcactccttgtcagcagt
gctcctacttcaagccctacaaaggaaacacaacagcagctgcagcaattactgctggac
ttacagatgcttttgagaggcaccactaatcacaagaattctgaactctccaggatgctc
acatttaaattttacatgcccaagaaggccacagaattgacacatcttcagtgcctggaa
gaagaactacagcctctgcaggaagtcctgagcttggctcagagcaaaagctttcacttg
aaagacaccagggagttcatcagcaacatcaaagtaaccattctgaaactaaagggctct
gaaaacacattcatgtgtgactatgatgatgagacagcgactgttgtggaatttctgagc
agatggatcaccttctgtcaaagcctcatttcaacattgacatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747042
Entry
103747042         CDS       T03372                                 

Gene name
Csf2
Definition
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04650  Natural killer cell mediated cytotoxicity
ngi04657  IL-17 signaling pathway
ngi04660  T cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04668  TNF signaling pathway
ngi05146  Amoebiasis
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05171  Coronavirus disease - COVID-19
ngi05202  Transcriptional misregulation in cancer
ngi05221  Acute myeloid leukemia
ngi05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103747042 (Csf2)
   04668 TNF signaling pathway
    103747042 (Csf2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103747042 (Csf2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103747042 (Csf2)
   04650 Natural killer cell mediated cytotoxicity
    103747042 (Csf2)
   04660 T cell receptor signaling pathway
    103747042 (Csf2)
   04657 IL-17 signaling pathway
    103747042 (Csf2)
   04664 Fc epsilon RI signaling pathway
    103747042 (Csf2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103747042 (Csf2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103747042 (Csf2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103747042 (Csf2)
   05171 Coronavirus disease - COVID-19
    103747042 (Csf2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103747042 (Csf2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103747042 (Csf2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103747042 (Csf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ngi03019]
    103747042 (Csf2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103747042 (Csf2)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103747042 (Csf2)
Messenger RNA biogenesis [BR:ngi03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     103747042 (Csf2)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103747042 (Csf2)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Cytokines
   103747042 (Csf2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 103747042
NCBI-ProteinID: XP_008847566
LinkDB
Position
Un
AA seq 144 aa
MWLQSALLLGTVVCSLSAPTRLPTPVTRPWKHVDAIKEALSLLNCSHDTPAMLKETVEVV
SVRFDSQKPTCLQTRLKLFQDGLQGSLTKLQGPLSLMASHYQKNCPPTPETDCETEVLTF
TDFKEYLKSFLFKIPFDCWEPVQN
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggctgcagagtgcgcttcttctgggcactgtggtctgcagtttgtcagcacctacc
cgcctacccacccctgtcactcggccctggaaacacgtggatgccatcaaagaagccctg
agcctcctcaactgcagtcatgacacgcctgctatgttgaaagaaactgtagaagtcgtc
tctgtaaggtttgacagccagaagccgacatgcttgcagacccgcctgaagttgttccag
gacggtctacagggcagcctcaccaagctccagggccccctgagcctgatggctagccac
taccagaagaactgtccccccaccccggaaactgactgcgagacagaggttcttaccttc
acagatttcaaagagtacctcaagagctttctgtttaagattccctttgactgttgggag
cctgtccagaactga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747045
Entry
103747045         CDS       T03372                                 

Gene name
Il5
Definition
(RefSeq) interleukin 5
  KO
K05428  interleukin 5
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04657  IL-17 signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi05200  Pathways in cancer
ngi05310  Asthma
ngi05320  Autoimmune thyroid disease
ngi05321  Inflammatory bowel disease
ngi05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103747045 (Il5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103747045 (Il5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103747045 (Il5)
   04660 T cell receptor signaling pathway
    103747045 (Il5)
   04658 Th1 and Th2 cell differentiation
    103747045 (Il5)
   04657 IL-17 signaling pathway
    103747045 (Il5)
   04664 Fc epsilon RI signaling pathway
    103747045 (Il5)
   04672 Intestinal immune network for IgA production
    103747045 (Il5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747045 (Il5)
  09163 Immune disease
   05310 Asthma
    103747045 (Il5)
   05320 Autoimmune thyroid disease
    103747045 (Il5)
   05321 Inflammatory bowel disease
    103747045 (Il5)
   05330 Allograft rejection
    103747045 (Il5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103747045 (Il5)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103747045 (Il5)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103747045 (Il5)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Cytokines
   103747045 (Il5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 103747045
NCBI-ProteinID: XP_008847570
LinkDB
Position
Un
AA seq 134 aa
MRVVLLLSMLALGAASIWAIAVEPSISTMVKQTLTLLSTHRALLTRNETVRIPVPTHKNH
QLCIGEIFRGIDTLRNQTAHGSAVEKLFQNLSLIKRYISHQKEKCGEERRRARQFLDYLQ
EFLGVLNTEWTLED
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagagtggtcctgcttttgagcatgctggctcttggagctgcctccatttgggccata
gctgtggaaccttccatcagcaccatggtgaaacagaccttgacgttgctgtccactcac
cgagctctgctgacaaggaatgagacggtgaggattcctgttcctacacataaaaatcac
cagctgtgcattggagaaatcttccggggaatagacactctgaggaatcaaactgcccat
gggagtgctgtggaaaagctatttcaaaacttgtcattaataaagagatacatcagccac
cagaaagaaaagtgtggcgaggagagacgaagggcgaggcagttcctcgattacctgcag
gagtttcttggtgtgctgaatactgaatggaccttggaagactga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747046
Entry
103747046         CDS       T03372                                 

Gene name
Il13
Definition
(RefSeq) interleukin 13
  KO
K05435  interleukin 13
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04657  IL-17 signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04664  Fc epsilon RI signaling pathway
ngi05200  Pathways in cancer
ngi05310  Asthma
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103747046 (Il13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103747046 (Il13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103747046 (Il13)
   04657 IL-17 signaling pathway
    103747046 (Il13)
   04664 Fc epsilon RI signaling pathway
    103747046 (Il13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747046 (Il13)
  09163 Immune disease
   05310 Asthma
    103747046 (Il13)
   05321 Inflammatory bowel disease
    103747046 (Il13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103747046 (Il13)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103747046 (Il13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 103747046
NCBI-ProteinID: XP_008847571
LinkDB
Position
Un
AA seq 137 aa
MALWVTVVLALTCLGGFAAPGPVPRPVPYPVPSPVALKELIEELTNITLDQKTPLCNSSM
VWSVDLTDGGYCAALESLINISNCNAIHKTQRILNGLCTRKASAGVSSLPDTKVEVAQFI
KTLLTYSRKLFRTNKVY
NT seq 414 nt   +upstreamnt  +downstreamnt
atggcactctgggtgactgtggtcctggctctcacctgcctcggtggttttgctgcccca
ggcccagtgccgcgcccagtgccatacccagtgccttcccctgtggccctcaaggagctc
atcgaggagctgaccaacatcacgctagaccagaagactcccctgtgtaacagcagcatg
gtgtggagcgtggacctgacagatggcgggtactgtgcagccctggagtccctgatcaac
atctccaactgcaatgccatccacaagacccagcggatactgaatggactctgcacccgc
aaggcctcagctggggtttccagcctcccagataccaaagtcgaagtggcccagttcata
aagaccctgctcacttattcaaggaagctttttcgcaccaacaaggtctactga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747047
Entry
103747047         CDS       T03372                                 

Gene name
Il4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04657  IL-17 signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi05140  Leishmaniasis
ngi05200  Pathways in cancer
ngi05310  Asthma
ngi05320  Autoimmune thyroid disease
ngi05321  Inflammatory bowel disease
ngi05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103747047 (Il4)
   04151 PI3K-Akt signaling pathway
    103747047 (Il4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103747047 (Il4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103747047 (Il4)
   04660 T cell receptor signaling pathway
    103747047 (Il4)
   04658 Th1 and Th2 cell differentiation
    103747047 (Il4)
   04659 Th17 cell differentiation
    103747047 (Il4)
   04657 IL-17 signaling pathway
    103747047 (Il4)
   04664 Fc epsilon RI signaling pathway
    103747047 (Il4)
   04672 Intestinal immune network for IgA production
    103747047 (Il4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747047 (Il4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    103747047 (Il4)
  09163 Immune disease
   05310 Asthma
    103747047 (Il4)
   05320 Autoimmune thyroid disease
    103747047 (Il4)
   05321 Inflammatory bowel disease
    103747047 (Il4)
   05330 Allograft rejection
    103747047 (Il4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103747047 (Il4)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103747047 (Il4)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interleukins
   103747047 (Il4)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Cytokines
   103747047 (Il4)
SSDB
Motif
Pfam: IL4 FANCI_S4
Other DBs
NCBI-GeneID: 103747047
NCBI-ProteinID: XP_008847572
LinkDB
Position
Un
AA seq 147 aa
MGLTPQLAATLLCLLVCAGNFAHGCNSENLAEIIHILNRLTSKGTPCTEMLVPDVFTETK
NTTEEKILCRTQKVLRKFYNSHIPCLKNNTLVLKDLQKVYRIVCSMSQLRNCTVSESTQI
TLKTFLESLKRMMQKKYNSAEAECLNL
NT seq 444 nt   +upstreamnt  +downstreamnt
atgggtctcaccccccagctggctgccacactcctctgcctcctagtatgtgctggcaac
tttgcccatggatgcaacagcgaaaacttagcagagatcatccatattttgaaccggctc
acaagcaaagggactccttgcaccgagatgcttgtgccagatgtctttacagaaaccaag
aacaccactgaggagaagatcctctgcaggacgcagaaggtgctccggaagttctataac
tcacatattccgtgcttgaaaaacaacaccttggttctcaaagacttgcaaaaagtctac
aggattgtctgcagcatgtcccagctgcgcaactgcaccgtgagtgaatccacacagata
acactgaaaaccttcttggaaagcctgaaaaggatgatgcaaaagaaatataacagtgca
gaagctgaatgtcttaatttatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750789
Entry
103750789         CDS       T03372                                 

Definition
(RefSeq) interferon lambda-2-like
  KO
K22669  interferon lambda 2/3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103750789
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103750789
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103750789
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interferons
   103750789
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 103750789
NCBI-ProteinID: XP_017658873
LinkDB
Position
Un
AA seq 218 aa
MGPRLFGPQRPPSALHYPPHLQSLGLLLLTLPLLLAAVLTRTWAVPVPMTTGVPPDAKDC
HMAQFKSLSPQELQAFKTAKDAIEDWLVEKDVRCGSRLFPRAWDLGQLQVQERLEALQAE
LALTLKVLESVAEPALKTLLDQPLHTLRHILSQLRACTQAPPTADPRPQSRRLSRWLHRL
QEAQKKETPGCLQASVTFNLYRLLTRDLKCVASGAQCV
NT seq 657 nt   +upstreamnt  +downstreamnt
atggggccgagactgtttggaccacagcggcctccatctgccctgcattatcctcctcat
ctgcaatcccttgggcttctcctcttgaccctccccttgctgctggctgcggtgctgacc
aggacctgggcagttcctgtccccatgactaccggtgtcccaccagatgcaaaggactgc
cacatggctcagttcaagtctctgtccccacaagagctgcaggccttcaagacggccaaa
gatgccattgaagactggctggtggagaaggatgtcaggtgtggttcccgcctcttcccc
agggcctgggacctggggcagctgcaggtgcaggagcgcctggaggccttgcaggctgag
ctggctctgactctgaaggttctggagagcgtggcagaaccagccctgaagaccctcctg
gaccagccccttcacacactgcgccacatcctctcccagctgcgggcctgcacccaggct
ccacccactgcagaccccaggccacagagccgccgcctctcccgctggctgcaccggctc
caggaggcccagaagaaggagacccccggctgcctgcaggcctctgtcactttcaacctc
taccgcctgctcacccgggacctgaaatgtgtggccagcggtgcccagtgtgtctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750790
Entry
103750790         CDS       T03372                                 

Definition
(RefSeq) interferon lambda-2-like
  KO
K22669  interferon lambda 2/3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103750790
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103750790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103750790
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interferons
   103750790
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 103750790
NCBI-ProteinID: XP_017658874
LinkDB
Position
Un
AA seq 216 aa
MISAPMIHCWIIADPEPQSPSLGLLLLTLPLLLAAVLTRTWAVPVPMTTGVPPDAKDCHM
AQFKSLSPQELQAFKTAKDAIEDWLVEKDVRCGSRLFPRAWDLGQLQVQERLEALQAELA
LTLKVLESVAEPALKTLLDQPLHTLRHILSQLRACTQAPPTADPRPQSRRLSRWLHRLQE
AQKKETPGCLQASVTFNLYRLLTRDLKCVASAAQCV
NT seq 651 nt   +upstreamnt  +downstreamnt
atgatctcggccccaatgatccattgctggatcattgcagaccctgagccccagtccccc
tcccttgggcttctcctcttgaccctccccttgctgctggctgcggtgctgaccaggacc
tgggcagttcctgtccccatgactaccggtgtcccaccagatgcaaaggactgccacatg
gctcagttcaagtctctgtccccacaagagctgcaggccttcaagacggccaaagatgcc
attgaagactggctggtggagaaggatgtcaggtgtggttcccgcctcttccccagggcc
tgggacctggggcagctgcaggtgcaggagcgcctggaggccttgcaggctgagctggct
ctgactctgaaggttctggagagcgtggcagaaccagccctgaagaccctcctggaccag
ccccttcacacactgcgccacatcctctcccagctgcgggcctgcacccaggctccaccc
actgcagaccccaggccacagagccgccgcctctcccgctggctgcaccggctccaggag
gcccagaagaaggagacccccggctgcctgcaggcctctgtcactttcaacctctaccgc
ctgctcacccgggacctgaaatgtgtggccagcgctgcccagtgtgtctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750791
Entry
103750791         CDS       T03372                                 

Gene name
Ifnl1
Definition
(RefSeq) interferon lambda-1
  KO
K05447  interferon lambda 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103750791 (Ifnl1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103750791 (Ifnl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103750791 (Ifnl1)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Interferons
   103750791 (Ifnl1)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 103750791
NCBI-ProteinID: XP_008852259
LinkDB
Position
Un
AA seq 192 aa
MVAVWLLLPAAIMLGLAIAAPFPPSKPTTAKTSCHINSFQSLSQQELNTFKKAKDALEET
LLQKDVRCSTKPFPSGWDLRQLQVQERPEALQAELAPTLKVLESVAEPSLRTLLYQPLHT
LRHIRSQLHTCIPGPPIADPRPQSHRLSHWLHLLWKAQKKETPGCLQASVTFNLYCLLTR
DLKCVASGDQGV
NT seq 579 nt   +upstreamnt  +downstreamnt
atggttgcagtgtggctgctgctccctgcagccataatgctgggcttggccatagctgct
cctttccctccttccaagcccaccactgccaagactagctgccatattaacagcttccaa
tctctgtcacaacaggagttaaatacctttaagaaagccaaagatgctttggaagagaca
ttgctgcagaaggatgtcaggtgcagtaccaagccattccccagtggctgggacctgaga
cagcttcaggtgcaggagcgccccgaggccttgcaggctgagctggccccgacgttgaag
gttctggagagtgtggctgaaccatccctgaggaccctcctgtatcagcctcttcacaca
ctgcgccacatccgctcccagctgcatacctgcatcccgggtccacccatcgcagacccc
aggccccagagccaccgcctctcccactggctgcacctgctctggaaggcccagaagaag
gagactcctggttgcctgcaggcttcggtcaccttcaatctctactgcctgctcacccgg
gacctgaaatgtgtggccagtggagaccagggtgtgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103752298
Entry
103752298         CDS       T03372                                 

Gene name
Tslp
Definition
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103752298 (Tslp)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103752298 (Tslp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103752298 (Tslp)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103752298 (Tslp)
SSDB
Motif
Pfam: TSLP DUF4842 Phage_term_smal
Other DBs
NCBI-GeneID: 103752298
NCBI-ProteinID: XP_017650581
LinkDB
Position
Un
AA seq 238 aa
MGKDREMQATEHKCLQMNIFLLFVLSVFFRKLFVLQLVGLVLTYNFSNCDFKKIVIIYDE
IISEDLKVPGKFTQIQPCYNAEEKANAKRSRDQGTESETPPPGVPSICCQHWLLTAAWEA
GRSEQAPSSCFPLLAPFHSIFNSWRFPHFSLNSAACEQTDCLMKIEHQTFNPASGCPSLP
RKPFAIKTKSTLTLHCPGYSGTQRNTTNQKTGKDIERNCRNQMLQIIAWWRHFCQIPK
NT seq 717 nt   +upstreamnt  +downstreamnt
atggggaaggacagggaaatgcaagccacagagcacaagtgtttacaaatgaacattttc
ttactgtttgttctgtcagtttttttcaggaagctcttcgtccttcaattggtagggctg
gtgctaacttataacttctctaactgtgactttaagaagattgtgatcatctatgatgaa
ataatttctgaagacctgaaggtcccgggcaagttcacccaaatacagccctgttacaat
gcggaggaaaaagcaaatgccaagcgaagccgggaccagggaacggagtctgagacacca
cctcccggagtccccagcatctgctgtcagcactggctcttgacagctgcctgggaggct
gggcggagcgagcaggcaccttcatcttgctttcctctccttgccccctttcattcaatt
tttaattcctggcgtttcccccatttctccttgaactctgccgcttgtgagcagacagat
tgcctcatgaaaatagagcaccagacttttaatcctgccagtggctgcccttcactaccc
cggaaaccattcgccataaaaacgaagtctaccctcactctccactgcccaggctactct
ggaactcagagaaacactactaaccagaaaacagggaaagacattgaacgcaactgtcgg
aatcaaatgttacaaatcatagcatggtggcgtcatttctgtcaaattccaaaataa

DBGET integrated database retrieval system