KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724646
Entry
103724646         CDS       T03372                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2-like
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04360  Axon guidance
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04670  Leukocyte transendothelial migration
ngi04713  Circadian entrainment
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04727  GABAergic synapse
ngi04728  Dopaminergic synapse
ngi04730  Long-term depression
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04921  Oxytocin signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04924  Renin secretion
ngi04926  Relaxin signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04971  Gastric acid secretion
ngi05012  Parkinson disease
ngi05030  Cocaine addiction
ngi05032  Morphine addiction
ngi05034  Alcoholism
ngi05133  Pertussis
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05163  Human cytomegalovirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103724646
   04371 Apelin signaling pathway
    103724646
   04071 Sphingolipid signaling pathway
    103724646
   04024 cAMP signaling pathway
    103724646
   04022 cGMP-PKG signaling pathway
    103724646
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103724646
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103724646
   04670 Leukocyte transendothelial migration
    103724646
   04062 Chemokine signaling pathway
    103724646
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103724646
   04915 Estrogen signaling pathway
    103724646
   04914 Progesterone-mediated oocyte maturation
    103724646
   04921 Oxytocin signaling pathway
    103724646
   04926 Relaxin signaling pathway
    103724646
   04935 Growth hormone synthesis, secretion and action
    103724646
   04928 Parathyroid hormone synthesis, secretion and action
    103724646
   04916 Melanogenesis
    103724646
   04924 Renin secretion
    103724646
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103724646
  09154 Digestive system
   04971 Gastric acid secretion
    103724646
  09156 Nervous system
   04724 Glutamatergic synapse
    103724646
   04727 GABAergic synapse
    103724646
   04725 Cholinergic synapse
    103724646
   04728 Dopaminergic synapse
    103724646
   04726 Serotonergic synapse
    103724646
   04730 Long-term depression
    103724646
   04723 Retrograde endocannabinoid signaling
    103724646
  09158 Development and regeneration
   04360 Axon guidance
    103724646
  09159 Environmental adaptation
   04713 Circadian entrainment
    103724646
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103724646
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103724646
  09165 Substance dependence
   05030 Cocaine addiction
    103724646
   05032 Morphine addiction
    103724646
   05034 Alcoholism
    103724646
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103724646
  09171 Infectious disease: bacterial
   05133 Pertussis
    103724646
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103724646
   05163 Human cytomegalovirus infection
    103724646
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103724646
   05142 Chagas disease
    103724646
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103724646
   04031 GTP-binding proteins [BR:ngi04031]
    103724646
Exosome [BR:ngi04147]
 Exosomal proteins
  Proteins found in most exosomes
   103724646
GTP-binding proteins [BR:ngi04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    103724646
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 AAA_16
Other DBs
NCBI-GeneID: 103724646
NCBI-ProteinID: XP_008819998
LinkDB
Position
Un
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRGDDARQLFALSCAAEEQGML
PEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKELHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITQSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNMKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcaccgtgagcgccgaggacaaggcggcggccgagcgctccaaaatgatcgac
aagaacctgcgggaggacggcgagaaggcggcgcgcgaggtgaagttgctcctgttaggt
gctggggagtcggggaagagcaccatcgtcaagcagatgaagatcatccatgaggctggc
tactcagaggaggaatgtcggcagtatcgagcagttgtctatagcaacaccatccagtct
atcatggccattgtcaaggccatgggcaacctgcagattgactttgcagacccccaacgt
ggggatgatgccagacagctgtttgcactgtcttgcgctgctgaggagcaaggtatgctc
cccgaagacctgtctggtgtcatccggaggctctgggctgaccatggtgtgcaagcctgt
tttggccgctctcgggagtaccagctcaatgactcggctgcctattacctgaatgacctg
gagcgcattgcacagagtgactacatccccacgcagcaggatgtgctgcggacccgtgtg
aaaaccacgggcatcgtggaaacacatttcaccttcaaggaattacatttcaagatgttt
gatgtgggtggtcagcggtctgagcggaagaagtggatccattgcttcgagggtgtcaca
gctatcattttctgtgtagccttaagcgcctatgacttggtgctggctgaggatgaggag
atgaatcgcatgcatgagagcatgaagctgtttgacagcatctgcaacaataagtggttc
acagacacatccatcatcctcttcctcaataagaaggacctgtttgaggagaaaatcacc
cagagcccgctgaccatctgcttccctgagtacacaggggcgaacaagtatgacgaggca
gccagctacatccagagcaaatttgaggacctgaataaacgcaaagacaccaaggagata
tacacgcacttcacatgtgccaccgataccaagaacgtgcagtttgtgtttgatgctgtc
accgacgtcatcatcaagaacaacatgaaggactgtggcctcttctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732220
Entry
103732220         CDS       T03372                                 

Gene name
Gnai1
Definition
(RefSeq) G protein subunit alpha i1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04360  Axon guidance
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04670  Leukocyte transendothelial migration
ngi04713  Circadian entrainment
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04727  GABAergic synapse
ngi04728  Dopaminergic synapse
ngi04730  Long-term depression
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04921  Oxytocin signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04924  Renin secretion
ngi04926  Relaxin signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04971  Gastric acid secretion
ngi05012  Parkinson disease
ngi05030  Cocaine addiction
ngi05032  Morphine addiction
ngi05034  Alcoholism
ngi05133  Pertussis
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05163  Human cytomegalovirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103732220 (Gnai1)
   04371 Apelin signaling pathway
    103732220 (Gnai1)
   04071 Sphingolipid signaling pathway
    103732220 (Gnai1)
   04024 cAMP signaling pathway
    103732220 (Gnai1)
   04022 cGMP-PKG signaling pathway
    103732220 (Gnai1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103732220 (Gnai1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103732220 (Gnai1)
   04670 Leukocyte transendothelial migration
    103732220 (Gnai1)
   04062 Chemokine signaling pathway
    103732220 (Gnai1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103732220 (Gnai1)
   04915 Estrogen signaling pathway
    103732220 (Gnai1)
   04914 Progesterone-mediated oocyte maturation
    103732220 (Gnai1)
   04921 Oxytocin signaling pathway
    103732220 (Gnai1)
   04926 Relaxin signaling pathway
    103732220 (Gnai1)
   04935 Growth hormone synthesis, secretion and action
    103732220 (Gnai1)
   04928 Parathyroid hormone synthesis, secretion and action
    103732220 (Gnai1)
   04916 Melanogenesis
    103732220 (Gnai1)
   04924 Renin secretion
    103732220 (Gnai1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103732220 (Gnai1)
  09154 Digestive system
   04971 Gastric acid secretion
    103732220 (Gnai1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103732220 (Gnai1)
   04727 GABAergic synapse
    103732220 (Gnai1)
   04725 Cholinergic synapse
    103732220 (Gnai1)
   04728 Dopaminergic synapse
    103732220 (Gnai1)
   04726 Serotonergic synapse
    103732220 (Gnai1)
   04730 Long-term depression
    103732220 (Gnai1)
   04723 Retrograde endocannabinoid signaling
    103732220 (Gnai1)
  09158 Development and regeneration
   04360 Axon guidance
    103732220 (Gnai1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103732220 (Gnai1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103732220 (Gnai1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103732220 (Gnai1)
  09165 Substance dependence
   05030 Cocaine addiction
    103732220 (Gnai1)
   05032 Morphine addiction
    103732220 (Gnai1)
   05034 Alcoholism
    103732220 (Gnai1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103732220 (Gnai1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    103732220 (Gnai1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103732220 (Gnai1)
   05163 Human cytomegalovirus infection
    103732220 (Gnai1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103732220 (Gnai1)
   05142 Chagas disease
    103732220 (Gnai1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103732220 (Gnai1)
   04031 GTP-binding proteins [BR:ngi04031]
    103732220 (Gnai1)
Exosome [BR:ngi04147]
 Exosomal proteins
  Proteins found in most exosomes
   103732220 (Gnai1)
GTP-binding proteins [BR:ngi04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    103732220 (Gnai1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE AAA_16
Other DBs
NCBI-GeneID: 103732220
NCBI-ProteinID: XP_008829007
LinkDB
Position
Un
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
TELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQSNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgctgagcgcggaggacaaggcggcggtggagcgcagcaagatgatcgac
cgcaacctccgcgaggacggcgagaaggcggcgcgcgaggtcaagctgttgctgctcggt
gctggtgaatctgggaaaagtacaattgtgaagcaaatgaaaattatccatgaagctggt
tattcagaagaggaatgtaaacagtacaaagcagtggtctacagcaacaccattcagtca
attattgccatcatcagagcaatggggaggttgaagatagactttggtgactcagctcgg
gcggatgatgctcgccaactcttcgtgcttgctggagctgccgaggaaggctttatgacc
acagagcttgctggagtcataaagagattgtggaaagacagtggtgtgcaagcctgtttc
aacagatcccgagagtatcagcttaatgattctgcagcatactatttgaatgatttggac
agaatagcacaatcaaattacatcccaactcagcaagatgtcctcagaactagagtgaaa
accacaggaattgtcgaaacccattttactttcaaagatcttcattttaaaatgtttgat
gtgggaggtcagaggtcagagcgtaagaagtggattcactgctttgaaggcgtgacggcc
atcattttctgtgtggccctgagtgactatgacctggttctggctgaagatgaagaaatg
aatcggatgcatgaaagcatgaaattattcgacagtatatgcaacaacaagtggtttaca
gatacatctattatactttttctaaacaagaaggatctctttgaagaaaaaatcaaaaag
agccctctcactatatgctacccagaatacgcaggatcaaacacatatgaagaggcagct
gcatatattcagtgtcagtttgaagatctcaataaaagaaaggacacgaaggaaatatac
acccacttcacatgtgccacagatacaaagaatgtgcagtttgtttttgatgctgtaaca
gatgtcatcataaaaaataacctgaaagattgtggtctcttttaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747835
Entry
103747835         CDS       T03372                                 

Gene name
Gnai3
Definition
(RefSeq) G protein subunit alpha i3
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04360  Axon guidance
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04670  Leukocyte transendothelial migration
ngi04713  Circadian entrainment
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04727  GABAergic synapse
ngi04728  Dopaminergic synapse
ngi04730  Long-term depression
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04921  Oxytocin signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04924  Renin secretion
ngi04926  Relaxin signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04971  Gastric acid secretion
ngi05012  Parkinson disease
ngi05030  Cocaine addiction
ngi05032  Morphine addiction
ngi05034  Alcoholism
ngi05133  Pertussis
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05163  Human cytomegalovirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103747835 (Gnai3)
   04371 Apelin signaling pathway
    103747835 (Gnai3)
   04071 Sphingolipid signaling pathway
    103747835 (Gnai3)
   04024 cAMP signaling pathway
    103747835 (Gnai3)
   04022 cGMP-PKG signaling pathway
    103747835 (Gnai3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103747835 (Gnai3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103747835 (Gnai3)
   04670 Leukocyte transendothelial migration
    103747835 (Gnai3)
   04062 Chemokine signaling pathway
    103747835 (Gnai3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103747835 (Gnai3)
   04915 Estrogen signaling pathway
    103747835 (Gnai3)
   04914 Progesterone-mediated oocyte maturation
    103747835 (Gnai3)
   04921 Oxytocin signaling pathway
    103747835 (Gnai3)
   04926 Relaxin signaling pathway
    103747835 (Gnai3)
   04935 Growth hormone synthesis, secretion and action
    103747835 (Gnai3)
   04928 Parathyroid hormone synthesis, secretion and action
    103747835 (Gnai3)
   04916 Melanogenesis
    103747835 (Gnai3)
   04924 Renin secretion
    103747835 (Gnai3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103747835 (Gnai3)
  09154 Digestive system
   04971 Gastric acid secretion
    103747835 (Gnai3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103747835 (Gnai3)
   04727 GABAergic synapse
    103747835 (Gnai3)
   04725 Cholinergic synapse
    103747835 (Gnai3)
   04728 Dopaminergic synapse
    103747835 (Gnai3)
   04726 Serotonergic synapse
    103747835 (Gnai3)
   04730 Long-term depression
    103747835 (Gnai3)
   04723 Retrograde endocannabinoid signaling
    103747835 (Gnai3)
  09158 Development and regeneration
   04360 Axon guidance
    103747835 (Gnai3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103747835 (Gnai3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747835 (Gnai3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103747835 (Gnai3)
  09165 Substance dependence
   05030 Cocaine addiction
    103747835 (Gnai3)
   05032 Morphine addiction
    103747835 (Gnai3)
   05034 Alcoholism
    103747835 (Gnai3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103747835 (Gnai3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    103747835 (Gnai3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103747835 (Gnai3)
   05163 Human cytomegalovirus infection
    103747835 (Gnai3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103747835 (Gnai3)
   05142 Chagas disease
    103747835 (Gnai3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103747835 (Gnai3)
   04031 GTP-binding proteins [BR:ngi04031]
    103747835 (Gnai3)
Exosome [BR:ngi04147]
 Exosomal proteins
  Proteins found in most exosomes
   103747835 (Gnai3)
GTP-binding proteins [BR:ngi04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    103747835 (Gnai3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc FtsK_SpoIIIE TniB AAA_29 AAA_16
Other DBs
NCBI-GeneID: 103747835
NCBI-ProteinID: XP_008848609
LinkDB
Position
Un
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLRVDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
SELAGVIKRLWRDAGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVK
TTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaggacaaggcggcggtggagcggagcaagatgatcgac
cgcaatttgcgggtggacggggagaaagcggccaaagaagtgaagctgctgttgctcggt
gctggagaatctggtaaaagtaccatcgtgaagcagatgaaaatcattcatgaggatggc
tattcagaggaagaatgtaaacagtataaagtagttgtctacagcaacactatacagtcc
atcattgcaatcataagagctatgggacggttaaagattgattttggggaagctgccagg
gcagatgatgcccgacaattatttgttttagctggcagtgctgaagaaggagtcatgact
tcagaactagcaggagtgattaaacggttgtggcgagatgctggggtgcaagcatgcttt
agcagatccagggaatatcagctcaatgactctgcttcatattacctaaatgatttggat
agaatatcccaaaccaactacattccaactcagcaagatgttcttcggacaagagtgaag
accacaggcattgtggaaacgcatttcaccttcaaagagctgtacttcaaaatgtttgat
gtaggtggccaaagatcagaacgaaaaaaatggattcactgttttgagggagtaacagca
attatcttctgtgtggccctcagtgattatgaccttgtcctggcagaggacgaggagatg
aaccgaatgcatgaaagtatgaaactgtttgacagcatttgtaacaacaaatggtttaca
gatacttcaattattctcttccttaacaagaaagacctttttgaggaaaaaataaagagg
agtccattaacaatctgttatccagaatacacaggttccaatacatatgaagaggcagct
gcttacattcagtgccagtttgaagatctgaatagaagaaaagataccaaggagatctat
actcacttcacctgtgccacagacaccaaaaatgtgcagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtgggctttattga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750163
Entry
103750163         CDS       T03372                                 

Gene name
Gnai2
Definition
(RefSeq) G protein subunit alpha i2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04360  Axon guidance
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04670  Leukocyte transendothelial migration
ngi04713  Circadian entrainment
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04727  GABAergic synapse
ngi04728  Dopaminergic synapse
ngi04730  Long-term depression
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04921  Oxytocin signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04924  Renin secretion
ngi04926  Relaxin signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04971  Gastric acid secretion
ngi05012  Parkinson disease
ngi05030  Cocaine addiction
ngi05032  Morphine addiction
ngi05034  Alcoholism
ngi05133  Pertussis
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05163  Human cytomegalovirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103750163 (Gnai2)
   04371 Apelin signaling pathway
    103750163 (Gnai2)
   04071 Sphingolipid signaling pathway
    103750163 (Gnai2)
   04024 cAMP signaling pathway
    103750163 (Gnai2)
   04022 cGMP-PKG signaling pathway
    103750163 (Gnai2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103750163 (Gnai2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103750163 (Gnai2)
   04670 Leukocyte transendothelial migration
    103750163 (Gnai2)
   04062 Chemokine signaling pathway
    103750163 (Gnai2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103750163 (Gnai2)
   04915 Estrogen signaling pathway
    103750163 (Gnai2)
   04914 Progesterone-mediated oocyte maturation
    103750163 (Gnai2)
   04921 Oxytocin signaling pathway
    103750163 (Gnai2)
   04926 Relaxin signaling pathway
    103750163 (Gnai2)
   04935 Growth hormone synthesis, secretion and action
    103750163 (Gnai2)
   04928 Parathyroid hormone synthesis, secretion and action
    103750163 (Gnai2)
   04916 Melanogenesis
    103750163 (Gnai2)
   04924 Renin secretion
    103750163 (Gnai2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103750163 (Gnai2)
  09154 Digestive system
   04971 Gastric acid secretion
    103750163 (Gnai2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103750163 (Gnai2)
   04727 GABAergic synapse
    103750163 (Gnai2)
   04725 Cholinergic synapse
    103750163 (Gnai2)
   04728 Dopaminergic synapse
    103750163 (Gnai2)
   04726 Serotonergic synapse
    103750163 (Gnai2)
   04730 Long-term depression
    103750163 (Gnai2)
   04723 Retrograde endocannabinoid signaling
    103750163 (Gnai2)
  09158 Development and regeneration
   04360 Axon guidance
    103750163 (Gnai2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103750163 (Gnai2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103750163 (Gnai2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103750163 (Gnai2)
  09165 Substance dependence
   05030 Cocaine addiction
    103750163 (Gnai2)
   05032 Morphine addiction
    103750163 (Gnai2)
   05034 Alcoholism
    103750163 (Gnai2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103750163 (Gnai2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    103750163 (Gnai2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103750163 (Gnai2)
   05163 Human cytomegalovirus infection
    103750163 (Gnai2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103750163 (Gnai2)
   05142 Chagas disease
    103750163 (Gnai2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103750163 (Gnai2)
   04031 GTP-binding proteins [BR:ngi04031]
    103750163 (Gnai2)
Exosome [BR:ngi04147]
 Exosomal proteins
  Proteins found in most exosomes
   103750163 (Gnai2)
GTP-binding proteins [BR:ngi04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    103750163 (Gnai2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29
Other DBs
NCBI-GeneID: 103750163
NCBI-ProteinID: XP_008851365
LinkDB
Position
Un
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRADDARQLFALSCAAEEQGML
PEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKELHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITQSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcaccgtgagcgccgaggacaaggcggcggccgagcgctccaaaatgatcgac
aagaacctgcgggaggacggcgagaaggcggcgcgcgaggtgaagttgctcctgttaggt
gctggggagtcggggaagagcaccatcgtcaagcagatgaagatcatccatgaggctggc
tactcagaggaggaatgtcggcagtatcgagcagttgtctatagcaacaccatccagtct
atcatggccattgtcaaggccatgggcaacctgcagattgactttgcagacccccaacgt
gcggatgatgccagacagctgtttgcactgtcttgcgctgctgaggagcaaggtatgctc
cccgaagacctgtctggtgtcatccggaggctctgggctgaccatggtgtgcaagcctgt
tttggccgctctcgggagtaccagctcaatgactcggctgcctattacctgaatgacctg
gagcgcattgcacagagtgactacatccccacgcagcaggatgtgctgcggacccgtgtg
aaaaccacgggcatcgtggaaacacatttcaccttcaaggaattacatttcaagatgttt
gatgtgggtggtcagcggtctgagcggaagaagtggatccattgcttcgagggtgtcaca
gctatcattttctgtgtagccttaagcgcctatgacttggtgctggctgaggatgaggag
atgaatcgcatgcatgagagcatgaagctgtttgacagcatctgcaacaataagtggttc
acagacacatccatcatcctcttcctcaataagaaggacctgtttgaggagaaaatcacc
cagagcccgctgaccatctgcttccctgagtacacaggggcgaacaagtatgacgaggca
gccagctacatccagagcaaatttgaggacctgaataaacgcaaagacaccaaggagata
tacacgcacttcacgtgtgccaccgataccaagaacgtgcagtttgtgtttgatgctgtc
accgacgtcatcatcaagaacaacctgaaggactgtggcctcttctga

DBGET integrated database retrieval system