KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724772
Entry
103724772         CDS       T03372                                 

Gene name
Wnt3
Definition
(RefSeq) Wnt family member 3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103724772 (Wnt3)
   04390 Hippo signaling pathway
    103724772 (Wnt3)
   04150 mTOR signaling pathway
    103724772 (Wnt3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103724772 (Wnt3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103724772 (Wnt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103724772 (Wnt3)
   05206 MicroRNAs in cancer
    103724772 (Wnt3)
   05205 Proteoglycans in cancer
    103724772 (Wnt3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103724772 (Wnt3)
   05226 Gastric cancer
    103724772 (Wnt3)
   05217 Basal cell carcinoma
    103724772 (Wnt3)
   05224 Breast cancer
    103724772 (Wnt3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103724772 (Wnt3)
   05022 Pathways of neurodegeneration - multiple diseases
    103724772 (Wnt3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103724772 (Wnt3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103724772 (Wnt3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103724772 (Wnt3)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103724772 (Wnt3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103724772
NCBI-ProteinID: XP_008820137
LinkDB
Position
Un
AA seq 355 aa
MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctactcggcctcctgctcggtggcaccagggtcctc
gccggctacccaatttggtggtccctggccctgggccagcagtacacatctttgggctcc
cagcccctgctctgcggctctatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgaaatcatgcccagtgtggcagaaggcgtgaagctgggcatccaggagtgc
cagcaccagttccgaggccgccgctggaactgcaccaccatagatgacagcctggccatc
tttggacctgttctggacaaagccacccgcgagtcggccttcgtgcacgccatcgcctcg
gctggcgtagctttcgcggtcacgcgttcctgtgccgagggcacctccaccatctgcggc
tgtgactctcatcataaggggccacctggtgaaggctggaagtggggcggctgcagcgag
gacgctgacttcggggtgctggtgtcccgggagtttgcagacgcacgtgagaacaggcca
gatgcgcgctcggccatgaacaagcacaacaatgaggcaggccgcacgaccatcctggac
cacatgcacctcaagtgcaagtgccatgggctgtcaggcagctgtgaggttaagacctgc
tggtgggcccagcccgacttccgcgccattggtgacttcctcaaggacaaatatgacagc
gcctccgagatggttgtggagaagcaccgggaatcccggggctgggtggagacgctccgg
gccaagtatgcactctttaagccacccactgagagggacctggtgtactatgagaactcc
cccaacttttgtgagcccaacccagagacaggctcctttggcaccagggaccggacttgc
aatgtcacctcccatggcatcgatggttgcgatctgctctgctgtggccgtggccacaac
acgaggaccgagaagcggaaggagaagtgtcattgcatcttccactggtgctgctacgtc
agctgccaggaatgcatccgcatctatgatgtgcacacctgcaagtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724773
Entry
103724773         CDS       T03372                                 

Gene name
Wnt9b
Definition
(RefSeq) Wnt family member 9B
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103724773 (Wnt9b)
   04390 Hippo signaling pathway
    103724773 (Wnt9b)
   04150 mTOR signaling pathway
    103724773 (Wnt9b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103724773 (Wnt9b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103724773 (Wnt9b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103724773 (Wnt9b)
   05205 Proteoglycans in cancer
    103724773 (Wnt9b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103724773 (Wnt9b)
   05226 Gastric cancer
    103724773 (Wnt9b)
   05217 Basal cell carcinoma
    103724773 (Wnt9b)
   05224 Breast cancer
    103724773 (Wnt9b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103724773 (Wnt9b)
   05022 Pathways of neurodegeneration - multiple diseases
    103724773 (Wnt9b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103724773 (Wnt9b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103724773 (Wnt9b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103724773 (Wnt9b)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103724773 (Wnt9b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103724773
NCBI-ProteinID: XP_008820139
LinkDB
Position
Un
AA seq 359 aa
MRPAPTLALVALCLLALPVAAAAAAYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLL
KLSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRQERWNCSLEGRTGLLKRGFKETAF
LYAVSAAALTHALARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLG
PKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVL
KLRYDTAVKVSSATNEALDRLELWTPAKPGGPAKGLPPRPGDLVYMEDSPSFCRPSKYSP
GTAGRVCSRDASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCAQQELVYTCKR
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcgccccgcgcccacgctggccctggtcgcgctctgcctgctagcgctgcccgtcgcc
gccgccgccgccgcctacttcggcctaactgggcgcgaggtcctgacgcccttcccaggc
ctgggcacagcagcagctccggcacagggtggtgcccacctgaagcagtgtgacctgctg
aagctatcccgtcgccagaagcagctctgccggagggagcctggcctggctgaaaccctg
agggatgctgcacacctcggcctgctggaatgccagttccagttccgacaggagcggtgg
aactgcagcctggaggggaggactggcctgctcaagagaggcttcaaggagacagctttc
ctgtacgcagtgtctgcggccgccctcacgcatgcactagcccgggcttgcagtgccggt
cgcatggagcgctgtacctgtgacgactcccctggcctggagagtcggcaggcctggcag
tggggtgtgtgtggtgacaacctcaagtacagcaccaagtttctgagtaacttcctgggg
cccaagagaggaagcaaagacctacgggctcgagctgatgcccacaacacccatgtaggc
atcaaggccgtaaagagtggcctcaggactacctgtaagtgccatggagtgtcaggctcc
tgtgctgtgcgtacctgctggaagcagctctccccattccgagagacaggccaggtgctg
aagctgcgctatgacacagctgtcaaggtatctagtgccaccaatgaggccttagatcgc
ctggagctatggacacctgccaagccaggtggcccggctaagggcctgccaccccggcca
ggggacctggtctacatggaggattctcccagcttctgccggcccagcaagtactctcct
ggcacagctggaagggtgtgctcccgtgatgccagctgcagcagcctatgctgtgggcgg
ggctatgacacccagagccgcctggtggccttctcctgccactgccaggtgcagtggtgc
tgttacgtggagtgccagcagtgtgcacagcaggagcttgtgtatacctgtaagcgctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727729
Entry
103727729         CDS       T03372                                 

Gene name
Wnt6
Definition
(RefSeq) Wnt family member 6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103727729 (Wnt6)
   04390 Hippo signaling pathway
    103727729 (Wnt6)
   04150 mTOR signaling pathway
    103727729 (Wnt6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103727729 (Wnt6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103727729 (Wnt6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103727729 (Wnt6)
   05205 Proteoglycans in cancer
    103727729 (Wnt6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103727729 (Wnt6)
   05226 Gastric cancer
    103727729 (Wnt6)
   05217 Basal cell carcinoma
    103727729 (Wnt6)
   05224 Breast cancer
    103727729 (Wnt6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103727729 (Wnt6)
   05022 Pathways of neurodegeneration - multiple diseases
    103727729 (Wnt6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103727729 (Wnt6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103727729 (Wnt6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103727729 (Wnt6)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103727729 (Wnt6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103727729
NCBI-ProteinID: XP_008823958
LinkDB
Position
Un
AA seq 365 aa
MLPPVPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPGPAGSPDASAAWEWGGCGDDVDFGD
EKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctgccgccggtgccctcccgcctcgggctgctgctgctgctgctcctgtgtccggcg
cacgtcggaggcctgtggtgggccgtgggcagccccttagtcatggaccctaccagtatc
tgcagaaaggcccggaggctggcaggacggcaggctgagttgtgccaggcagagccggaa
gtggtggcagagctagcccggggagcgcggctcggggtgcgagaatgccagttccagttc
cgctttcgtcgctggaactgctccagccacagcaaggcctttgggcgcatcctgcagcag
gacatcagagagacagccttcgtgtttgcaatcactgcagctggcgccagccacgctgtc
acgcaggcctgttccatgggcgagcttctgcagtgcggttgccaagcaccacgcgggcgg
gcaccccctaggccctccggtctgctgggcaccccaggacccccaggcccagcaggctcc
ccagacgccagcgctgcttgggaatggggaggctgcggcgacgacgtggacttcggggac
gagaaatcaaggctctttatggatgcgcagcacaagcgcggacgcggagacatccgtgcg
ttggtgcaattgcacaacaatgaggcaggcaggctggcggtgcggagccacacacgcaca
gaatgcaagtgccatgggctttcgggttcgtgcgcgctgcgcacctgctggcagaagctg
cccccgttccgagaggtgggggcgcggctgctggagcgcttccacggcgcctcgcgtgtc
atgggcactaacgacggcaaagccctgctgcccgcggtccgcacgctcaagccgccgggc
cgagctgatctcctttatgccgctgactcgccggacttctgcgcccctaataggcgcacc
ggctctcctggcacccgtggccgagcctgcaacagcagtgccccggacctcagcggctgc
gacctgttgtgctgcggtcgtggacaccgccaggagagcgtacagctcgaggagaattgc
ctgtgccgcttccactggtgctgtgtggtgcagtgccaccgctgccgggtgcgcaaggag
ctcagtctgtgcctctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727730
Entry
103727730         CDS       T03372                                 

Gene name
Wnt10a
Definition
(RefSeq) Wnt family member 10A
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103727730 (Wnt10a)
   04390 Hippo signaling pathway
    103727730 (Wnt10a)
   04150 mTOR signaling pathway
    103727730 (Wnt10a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103727730 (Wnt10a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103727730 (Wnt10a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103727730 (Wnt10a)
   05205 Proteoglycans in cancer
    103727730 (Wnt10a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103727730 (Wnt10a)
   05226 Gastric cancer
    103727730 (Wnt10a)
   05217 Basal cell carcinoma
    103727730 (Wnt10a)
   05224 Breast cancer
    103727730 (Wnt10a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103727730 (Wnt10a)
   05022 Pathways of neurodegeneration - multiple diseases
    103727730 (Wnt10a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103727730 (Wnt10a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103727730 (Wnt10a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103727730 (Wnt10a)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103727730 (Wnt10a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103727730
NCBI-ProteinID: XP_008823959
LinkDB
Position
Un
AA seq 416 aa
MGSAYPRPWLRLPPRPQPRPELWALLFFLLLLAAAVPRSAPNDILGLRVPEPVLNANTVC
LTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYESP
IFSRGFRESAFAYAIAAAGVVHAVSNACALGKLQACGCDASRRGDEEAFRRKLHRLQVDA
LQRGKGLSHGVPEHPALPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHAR
MRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRAVGALLRNRFHRATLIR
PHNRNGGQLEPGPAGVPSPAPGTPVPRRRANPSDLVYFEKSPDFCEREPRLDSAGTVGRL
CNKSSAGPDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgggcagcgcctaccctcgcccctggctgcggctcccaccccggccccagccgcggcct
gagctctgggcgctcctgttctttctactgctgctggctgccgctgtgcccaggtcagca
cccaatgacatcctgggccttcgagtaccagagcctgtgctcaatgccaacacagtgtgc
ctgacattgcccggcctgagcaggcggcagatggaggtgtgtgtgcgtcaccctgacgtg
gccgcttctgccatccagggcatccagatcgccatccatgagtgccaacaccagttccgg
gaccagcgctggaactgctctagcctggagactcgaaacaaaatcccctacgaaagtccc
atcttcagcagaggttttcgagagagtgcttttgcctatgccatcgctgctgcaggggtg
gtgcacgcagtgtccaacgcgtgcgccctgggtaaactgcaggcctgcggttgcgacgcc
tccaggcgtggggacgaagaggccttccgtcggaagctgcaccgcctgcaagtagacgcc
ctgcaacgcgggaagggcctgagccacggggtcccggaacaccctgccctgccccctgcc
agtccaggcctgcaggactcctgggaatggggcggctgcagtcctgacgtgggcttcgga
gaacgcttctctaaggactttctggactcccgggagcctcacagagacatccacgctcgc
atgagactccacaataaccgagtgggccgacaggcggtgatggagaacatgcggcgaaag
tgcaagtgccatggcacgtcaggtagctgccagctcaagacgtgctggcaggtgacgcct
gaattccgcgcggtgggggcgctgctgcgcaaccgcttccaccgcgccacgctcatccgg
ccgcacaaccgcaacggaggccagctggagcccggccctgcgggggtaccctcgccagcc
ccgggcactcccgtgccgcgccgccgggccaacccctccgacttggtatacttcgagaaa
tctcccgacttctgcgagcgcgagccgcgcctggactcggcgggcactgtgggccgcctt
tgcaacaagagcagcgcgggcccggatggctgcggcagcatgtgctgcggccggggccac
aacatcctgcgccagacacgaagcgagcgctgccactgccgcttccactggtgctgcttc
gtggtctgcgaagaatgccgcatcaccgagtgggtcagcgtctgcaagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730373
Entry
103730373         CDS       T03372                                 

Gene name
Wnt7a
Definition
(RefSeq) Wnt family member 7A
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103730373 (Wnt7a)
   04390 Hippo signaling pathway
    103730373 (Wnt7a)
   04150 mTOR signaling pathway
    103730373 (Wnt7a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103730373 (Wnt7a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103730373 (Wnt7a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103730373 (Wnt7a)
   05205 Proteoglycans in cancer
    103730373 (Wnt7a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103730373 (Wnt7a)
   05226 Gastric cancer
    103730373 (Wnt7a)
   05217 Basal cell carcinoma
    103730373 (Wnt7a)
   05224 Breast cancer
    103730373 (Wnt7a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103730373 (Wnt7a)
   05022 Pathways of neurodegeneration - multiple diseases
    103730373 (Wnt7a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103730373 (Wnt7a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103730373 (Wnt7a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103730373 (Wnt7a)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103730373 (Wnt7a)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 103730373
NCBI-ProteinID: XP_008826816
LinkDB
Position
Un
AA seq 349 aa
MTRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgacccggaaagcgcggcgctgccttggccacctctttctcagcctgggcatggtctac
cttcggatcggtggcttctcttctgtggtagctctgggtgcgagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcaatctgccagagccggcccgacgccatcatc
gtcataggagaaggctcccaaatgggcctcgatgagtgtcagtttcagttccgaaatggt
cgttggaactgctcagcactgggggagcgcacagtcttcgggaaggagctcaaagtgggg
agccgggaggctgccttcacctatgccatcattgctgcgggtgtggcccacgccattaca
gctgcctgcacccagggcaatctgagtgactgtggctgcgacaaggagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggaaatcaagcagaatgcccggactctcatg
aacttacacaataatgaggcgggccgaaagatcctggaggagaacatgaagctggagtgt
aagtgtcatggtgtgtcaggctcctgtaccaccaagacatgctggaccacactgccacaa
ttccgagagctgggctacgtgctcaaggacaaatacaacgaggccgtccatgtggaaccc
gtgcgtgccagccgcaataagcggcccaccttcctaaagatcaagaagcccctgtcttac
cgcaagcccatggacacagacctggtatatatcgagaagtcacccaattactgtgaagag
gacccagtgacaggcagcgtgggtacacagggccgtgcctgcaataagacagccccacag
gccagcggttgtgacctcatgtgctgtggccgtggctacaacacacaccagtatgcccgc
gtgtggcaatgcaactgcaagttccactggtgctgctatgtcaagtgcaacacgtgcagt
gagcgcaccgagatgtacacgtgcaagtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730604
Entry
103730604         CDS       T03372                                 

Gene name
Wnt16
Definition
(RefSeq) Wnt family member 16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103730604 (Wnt16)
   04390 Hippo signaling pathway
    103730604 (Wnt16)
   04150 mTOR signaling pathway
    103730604 (Wnt16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103730604 (Wnt16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103730604 (Wnt16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103730604 (Wnt16)
   05202 Transcriptional misregulation in cancer
    103730604 (Wnt16)
   05205 Proteoglycans in cancer
    103730604 (Wnt16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103730604 (Wnt16)
   05226 Gastric cancer
    103730604 (Wnt16)
   05217 Basal cell carcinoma
    103730604 (Wnt16)
   05224 Breast cancer
    103730604 (Wnt16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103730604 (Wnt16)
   05022 Pathways of neurodegeneration - multiple diseases
    103730604 (Wnt16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103730604 (Wnt16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103730604 (Wnt16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103730604 (Wnt16)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103730604 (Wnt16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103730604
NCBI-ProteinID: XP_008827104
LinkDB
Position
Un
AA seq 364 aa
MDRAALLALPRLCALWAAVLALFPCGAQGNWMWLGIASFGVPEKLGCASLPLNSRQKELC
KRKPYLLPSIREGARLGIQECRSQFRHERWNCKVATPAAAPPDTGPLFGYELSSGTKETA
FIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRK
FLDFPIRNTTEKESKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSS
FEKIGHFLKDKYENSIQISDKTKRKVRRREKDQRKTPIRKDDLLYVHKSPNYCMEDKKLG
IPGTQGRECNRTSGGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRSCESMTDV
HTCK
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggacagagctgcgctcctggcactgcctcgcttgtgcgcgctgtgggctgcggtgctc
gcgctgttcccttgcggagcccagggcaactggatgtggttgggcatcgcctccttcggg
gttcctgagaagctgggctgcgccagcttgccactaaacagccgccagaaggagctgtgc
aagaggaaaccttacctgctgcccagcatccgcgagggcgccaggctgggcattcaggag
tgcaggagccagttccgacacgagagatggaactgcaaggtcgccacacccgccgcagcc
ccgccggacaccggtcccctctttggctatgagttgagcagtggcaccaaggagacagca
ttcatttatgctgtgatggctgcaggcctggtgcactctgtgactaggtcgtgcagtgca
ggaaacatgacagaatgctcctgcgataccaccttacagaatggtggctcagcaagtgaa
ggctggcattgggggggatgctctgatgatgtccagtacggcatgtggttcagcagaaag
ttcctagatttccccatcagaaataccacagaaaaagaaagcaaagtattgctggccatg
aacctacacaacaatgaagctggacggcaggctgtagccaagttgatgtcggtggactgc
cgctgccatggggtttcgggctcttgtgccgtgaaaacctgctggaaaaccatgtcttct
tttgaaaagattggccattttttaaaagataaatatgaaaacagcatccagatatcggac
aaaaccaagaggaaagtgcgcaggagagaaaaagatcagaggaagacacccatccgcaag
gatgacctactgtatgttcataagtctcccaactactgtatggaggacaaaaaactgggt
atcccagggacacaaggcagagagtgcaaccgcacatcaggaggcgcagacgggtgcaac
ctcctctgctgtggccgtggctacaacacccatgtggtcagacacgtggagaggtgtgag
tgtaagtttatctggtgctgctacgttcgctgcaggagctgtgaaagcatgaccgatgtc
catacttgtaagtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734912
Entry
103734912         CDS       T03372                                 

Gene name
Wnt2b
Definition
(RefSeq) Wnt family member 2B
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103734912 (Wnt2b)
   04390 Hippo signaling pathway
    103734912 (Wnt2b)
   04150 mTOR signaling pathway
    103734912 (Wnt2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103734912 (Wnt2b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103734912 (Wnt2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103734912 (Wnt2b)
   05205 Proteoglycans in cancer
    103734912 (Wnt2b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103734912 (Wnt2b)
   05226 Gastric cancer
    103734912 (Wnt2b)
   05217 Basal cell carcinoma
    103734912 (Wnt2b)
   05224 Breast cancer
    103734912 (Wnt2b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103734912 (Wnt2b)
   05022 Pathways of neurodegeneration - multiple diseases
    103734912 (Wnt2b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103734912 (Wnt2b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103734912 (Wnt2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103734912 (Wnt2b)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103734912 (Wnt2b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103734912
NCBI-ProteinID: XP_008832185
LinkDB
Position
Un
AA seq 393 aa
MLKPRGAEEAAQLASRRARALVPAPAPRPLAPDVSPASARLSLACLLLLLLLTLPARVDT
SWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNC
TTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHD
QRGDFDWGGCSDNIHYGIRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECK
CHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRATRTD
LVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECK
FHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgctgaagccgcggggtgcggaggaagccgcgcagctcgcctctcggcgcgcccgcgcc
ctggtccccgcgccggcgcccagacccttggcccccgacgtgtccccggcttcggcccgt
ctgagtcttgcctgcctgttgctgctactactgctgacactgccggcccgtgtagacacg
tcctggtggtacataggggcactgggagcccgagtgatctgtgacaacatcccaggtttg
gtgagccggcagcggcagctgtgtcagcgttacccagatatcatgcgctccgtgggcgaa
ggcgcccgagaatggatccgagagtgtcagcatcagtttcgccatcaccgttggaactgc
accacactggaccgggaccacactgtctttggccgggtcatgctcagaagtagccgggag
gcagcatttgtatatgccatctcatcagcaggagtggtccacgcaatcactcgggcctgc
agccagggtgaactgagtgtgtgcagctgtgacccatatacccgtggtcgacaccatgac
caacgaggggactttgattggggtggctgcagtgacaacatccactatggtattcgcttt
gctaaggcctttgtggatgccaaggagaagaggctcaaggacgccagggccctcatgaac
ttacataacaaccgctgtggtcgtacggctgtgcgaagatttctgaagctggagtgtaag
tgtcatggtgtgagtggctcctgtactctgcgaacctgctggcgtgcactctcagacttc
cgccgcacaggtgattacctgcgtaggcgctatgatggggctgtgcaggtgacggccacc
caggatggtgccaatttcacagcagcccgccaaggctatcgtcgtgccacccgaactgac
cttgtctactttgataactctccagactactgtgtcttggacaaggctgcaggttcccta
ggtactgcaggtcgtgtctgcagcaagacatctaaaggaacagatggttgtgaaatcatg
tgttgcggccgagggtatgacacaactcgagtcacccgtgtcacccagtgtgagtgcaaa
ttccactggtgctgtgctgtacggtgcaaggagtgcagaaacactgtggacgtccacact
tgcaaggcccccaagaaagcagagtggttggaccagacctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735176
Entry
103735176         CDS       T03372                                 

Gene name
Wnt8a
Definition
(RefSeq) Wnt family member 8A
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103735176 (Wnt8a)
   04390 Hippo signaling pathway
    103735176 (Wnt8a)
   04150 mTOR signaling pathway
    103735176 (Wnt8a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103735176 (Wnt8a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103735176 (Wnt8a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103735176 (Wnt8a)
   05205 Proteoglycans in cancer
    103735176 (Wnt8a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103735176 (Wnt8a)
   05226 Gastric cancer
    103735176 (Wnt8a)
   05217 Basal cell carcinoma
    103735176 (Wnt8a)
   05224 Breast cancer
    103735176 (Wnt8a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103735176 (Wnt8a)
   05022 Pathways of neurodegeneration - multiple diseases
    103735176 (Wnt8a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103735176 (Wnt8a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103735176 (Wnt8a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103735176 (Wnt8a)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103735176 (Wnt8a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103735176
NCBI-ProteinID: XP_008832546
LinkDB
Position
Un
AA seq 411 aa
MGDLFMLWVTVGMCYATFSASAWSVNNFLITGPKAYLTYATSAALGAQSGIEECKFQFVW
ERWNCPENALQLSTHNRLRGATRETAFIHAISSAGVMHAITKNCSMGDFENCGCDESKKG
KTGGRGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRVGRLAARATMKRTC
KCHGLSGSCSIQTCWLQLASIREIGDYLKAKYDWALKIEMDKHQLRAGNSAEGHWDPMET
FFPGAEAELIFLEESPDYCTRNTSLGIYGTEGRECLQRSHNASRWEQHNCGRLCTECGLQ
VEERRTEATSSCNCKFQWCCTVKCDQCRHVVNKYYCRRYLGRARTRGKRGWFGVHIQRNL
KSICYIKFQTLSRPAVVLRVRETRIKEFPEKAILGRMRQKPPSPIGRFLEG
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgggggacttgtttatgctgtgggtgactgtgggcatgtgctatgccaccttcagtgcc
tctgcctggtcagtgaacaatttcctgataacaggtcccaaggcctatctgacctatgct
accagtgcagccttgggcgctcagagtggcatcgaagaatgtaagttccagtttgtgtgg
gaacgctggaactgtcctgaaaatgccctccaactctccacccataacagactgagaggt
gccacgagagagactgccttcattcatgccatcagctctgctggagtcatgcacgccatc
accaagaactgcagcatgggtgactttgaaaactgtggctgtgatgagtcaaaaaaggga
aaaacaggaggccgtggctggatctggggaggctgcagcgacaatgtggaatttggggaa
aggatctccaaactctttgtggacagtttggagaaggggaaggatgccagagccctgatg
aatcttcacaacaacagggtcggcaggctggcagcgagagccaccatgaaaaggacctgc
aaatgtcacggcctgtcagggagctgcagcatccagacatgctggctgcaactggctagc
attcgggagataggagactacctaaaggccaagtatgactgggcactgaaaattgagatg
gataagcatcagctcagggctggcaacagtgctgagggccactgggatcccatggagacc
ttctttcctggtgcagaggccgagttgatcttcttagaggaatctcctgactactgtaca
cgcaacaccagcctgggcatctatggcaccgagggtcgcgaatgcctgcagagaagccac
aacgcttccaggtgggaacaacacaactgtgggcgcttatgcactgagtgtggtctgcag
gtggaagagaggagaactgaggccacaagcagctgtaactgcaagttccagtggtgctgc
acagtcaagtgtgatcagtgtaggcacgtggtgaacaagtactactgcagaaggtatcta
ggcagagccaggacccggggcaagagaggatggtttggggtgcacatccagaggaacctg
aaaagcatttgttacattaagtttcagactctgtccaggccagctgtggtgctgagagtc
agggagactagaatcaaagaattccctgaaaaagcaatcttaggcagaatgaggcagaaa
ccaccttctcctattgggaggtttttagagggctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737375
Entry
103737375         CDS       T03372                                 

Gene name
Wnt2
Definition
(RefSeq) Wnt family member 2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103737375 (Wnt2)
   04390 Hippo signaling pathway
    103737375 (Wnt2)
   04150 mTOR signaling pathway
    103737375 (Wnt2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103737375 (Wnt2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103737375 (Wnt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103737375 (Wnt2)
   05205 Proteoglycans in cancer
    103737375 (Wnt2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103737375 (Wnt2)
   05226 Gastric cancer
    103737375 (Wnt2)
   05217 Basal cell carcinoma
    103737375 (Wnt2)
   05224 Breast cancer
    103737375 (Wnt2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103737375 (Wnt2)
   05022 Pathways of neurodegeneration - multiple diseases
    103737375 (Wnt2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103737375 (Wnt2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103737375 (Wnt2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103737375 (Wnt2)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103737375 (Wnt2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103737375
NCBI-ProteinID: XP_008835456
LinkDB
Position
Un
AA seq 360 aa
MNVPLGGIWLWLPLLLTWLTPEVSSSWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKSCSCDPKKKGSAKDSKGTFDWGGCSDNIDYGIKFARAFADAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWTTPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgtccctctcggtggaatctggctctggctccctctgctcttgacctggctcacc
cctgaggtcagctcttcatggtggtacatgagagctacaggtggctcctccagggtgatg
tgtgacaatgtgccaggcctggtgagccgccagcgtcagctgtgccaccgacatccagac
gtgatgcgtgccattggcctgggtgtggctgagtggacagcagagtgccaacaccagttc
cggcagcaccgctggaactgcaacactctagacagggatcacagcctctttggccgggtc
ctcctcagaagtagtcgggaatctgcctttgtttacgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaattaaaatcctgttcctgtgatccaaag
aagaagggaagtgccaaggacagcaagggtacctttgactggggtggctgcagcgacaac
attgactatgggatcaaatttgcccgagcgtttgcagatgccaaggaaaggaaagggaag
gatgccagagccctgatgaatcttcacaacaacagagccggaaggaaggcagtaaagcga
ttcctgaagcaagagtgcaagtgtcatggcgtgagtggctcctgtactctgaggacatgc
tggctggccatggccgacttcaggaaaacaggcgattatctctggaggaagtacaacggg
gccatccaggttgtcatgaaccaggatggcacaggcttcactgtggcaaataagagattt
aagaagccaacgaaaaatgacctcgtgtattttgagaactctccagactactgtatcagg
gaccgagaggcaggctccctgggtacagcaggtcgtgtgtgcaacttgacttcccgaggc
atggacagctgtgaagtcatgtgctgtgggagaggctatgacacctctcatgtcacccgg
atgaccaagtgtgagtgtaaattccactggtgctgtgctgtgcgctgtcaggactgcctg
gaggccctggatgtacacacatgcaaggcccccaagagtgccgattggacaacccctaca
tga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739037
Entry
103739037         CDS       T03372                                 

Gene name
Wnt3a
Definition
(RefSeq) Wnt family member 3A
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103739037 (Wnt3a)
   04390 Hippo signaling pathway
    103739037 (Wnt3a)
   04150 mTOR signaling pathway
    103739037 (Wnt3a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103739037 (Wnt3a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103739037 (Wnt3a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103739037 (Wnt3a)
   05206 MicroRNAs in cancer
    103739037 (Wnt3a)
   05205 Proteoglycans in cancer
    103739037 (Wnt3a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103739037 (Wnt3a)
   05226 Gastric cancer
    103739037 (Wnt3a)
   05217 Basal cell carcinoma
    103739037 (Wnt3a)
   05224 Breast cancer
    103739037 (Wnt3a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103739037 (Wnt3a)
   05022 Pathways of neurodegeneration - multiple diseases
    103739037 (Wnt3a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103739037 (Wnt3a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103739037 (Wnt3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103739037 (Wnt3a)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103739037 (Wnt3a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103739037
NCBI-ProteinID: XP_008837561
LinkDB
Position
Un
AA seq 352 aa
MATLGYFLVLCSLKQALGSYPIWWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGSAAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARTERRREKCQCVFHWCCYVSCQECTRVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggctacactcggatacttcttagtgctctgcagcctgaagcaggcactgggcagctac
ccgatctggtggtccttggctgtggggccccagtactcctccctgagcacccagcccatc
ctctgtgccagtattccgggcctggtgcccaagcagctgcgcttctgcaggaactacgtc
gagatcatgcccagtgtggctgagggcgtcaaggccggcattcaggagtgccaacatcag
ttccgtggccggcgctggaactgtaccactgtcagcaacagccttgccatctttggcccc
gtgctggacaaagccacccgggagtcagccttcgtccacgctatcgcctctgcgggagtg
gccttcgcagtgacacgctcctgtgctgagggttctgctgccatctgtgggtgcagtagc
cgcctccagggctccccaggcgagggctggaagtggggcggctgtagcgaggacattgaa
tttggaggaatggtgtctcgagagtttgcagatgcccgagagaaccgaccagatgcccgc
tctgctatgaaccgccataacaatgaggctgggcgtcaggccatcgccagccacatgcac
ctcaagtgcaaatgccatgggctgtcaggcagctgcgaggtgaaaacctgctggtggtct
cagcctgatttccggaccatcggcgacttcctcaaggacaagtacgacagcgcctccgag
atggtggtggagaaacaccgcgagtctcgtggctgggtggagaccctgcggccgcgctac
acgtacttcaaggtgcccacagagcgcgacctggtctattacgaggcgtcgcccaacttc
tgcgagcccaaccccgagaccggctcctttgggacacgcgaccgcacctgcaacgtgagc
tcgcacggcatcgacggctgcgacctgctgtgctgcggccgtggccacaacgcgcgcacc
gagcggcgcagggagaagtgccagtgcgtcttccactggtgctgctatgtcagctgtcaa
gagtgcacgcgcgtttacgacgtgcacacctgcaagtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739374
Entry
103739374         CDS       T03372                                 

Gene name
Wnt5b
Definition
(RefSeq) Wnt family member 5B
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103739374 (Wnt5b)
   04390 Hippo signaling pathway
    103739374 (Wnt5b)
   04150 mTOR signaling pathway
    103739374 (Wnt5b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103739374 (Wnt5b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103739374 (Wnt5b)
  09158 Development and regeneration
   04360 Axon guidance
    103739374 (Wnt5b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103739374 (Wnt5b)
   05205 Proteoglycans in cancer
    103739374 (Wnt5b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103739374 (Wnt5b)
   05226 Gastric cancer
    103739374 (Wnt5b)
   05217 Basal cell carcinoma
    103739374 (Wnt5b)
   05224 Breast cancer
    103739374 (Wnt5b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103739374 (Wnt5b)
   05022 Pathways of neurodegeneration - multiple diseases
    103739374 (Wnt5b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103739374 (Wnt5b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103739374 (Wnt5b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103739374 (Wnt5b)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103739374 (Wnt5b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103739374
NCBI-ProteinID: XP_008837973
LinkDB
Position
Un
AA seq 372 aa
MLVPGYWDGLRLTMPSLPLLFTAALLSSWAQLLTDASSWWSLAMNPVQRPEMFIIGAQPV
CSQLPGLSPGQRKLCQLYQEHMAYIGEGAKMGIRECQHQFRQRRWNCSTVDNTSVFGRVM
QIGSRETAFTYAVSAAGVVNAISRACREGELSTCGCSRAVRPKDLPRDWLWGGCGDNVEY
GYRFAKEFVDAREREKNFVKGSEEQGRALMNLQNNEAGRRAVYKMADVACKCHGVSGSCS
LKTCWLQLAEFRKVGDRLKEKYDGAAAMRITRQGKLELVNSRFNQPTPEDLVYVDPSPDY
CLRNETTGSMGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCKFHWCCFVRCK
KCTEIVDQYICK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgttggtcccagggtactgggacgggctgaggctgaccatgcccagcctccctttgctg
tttactgcagctctgctctccagctgggcccagctactgactgacgccagttcctggtgg
tcactagctatgaacccggtgcagagacctgagatgtttatcatcggtgctcagcctgtg
tgcagccagcttcctgggctctccccaggccagagaaagctatgccagttgtatcaggag
cacatggcctacatcggggagggagccaagatgggcatcagggagtgccagcaccagttc
cgacagaggaggtggaactgcagcaccgtggacaacacatccgtctttggcagagtcatg
cagataggcagccgggaaaccgccttcacctatgctgtgagtgctgctggtgtggtgaat
gccatcagccgtgcttgccgagagggtgagctgtccacttgtggttgcagccgggccgta
aggcccaaggacttgccacgagactggctgtggggtggctgtggggacaacgtggagtac
ggctaccgctttgctaaggagtttgtggatgctcgagagcgagagaagaactttgtcaag
ggctcagaggagcagggccgagccctcatgaacctacagaacaatgaggctggtcgccgg
gctgtgtataagatggctgatgttgcctgcaaatgtcacggggtctcagggtcctgcagc
ctcaagacctgctggctccagttggccgagttccgaaaggtgggagaccgtttgaaggag
aaatatgatggtgctgccgccatgcgcatcacccgccagggcaagctggagctggttaac
agccgctttaaccagcccaccccagaggacctggtctacgtggaccccagccctgattac
tgcctgcgcaatgagaccacaggctcgatgggcacccagggacgcctctgcaacaagacc
tcagagggcatggatggctgtgagctcatgtgctgtggccgtggctatgaccggtttaag
agcgtccaggtggagcgttgccactgcaaattccactggtgctgttttgtcagatgcaaa
aagtgcactgagattgttgaccagtacatctgtaaataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740409
Entry
103740409         CDS       T03372                                 

Gene name
Wnt9a
Definition
(RefSeq) Wnt family member 9A
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103740409 (Wnt9a)
   04390 Hippo signaling pathway
    103740409 (Wnt9a)
   04150 mTOR signaling pathway
    103740409 (Wnt9a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103740409 (Wnt9a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103740409 (Wnt9a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103740409 (Wnt9a)
   05205 Proteoglycans in cancer
    103740409 (Wnt9a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103740409 (Wnt9a)
   05226 Gastric cancer
    103740409 (Wnt9a)
   05217 Basal cell carcinoma
    103740409 (Wnt9a)
   05224 Breast cancer
    103740409 (Wnt9a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103740409 (Wnt9a)
   05022 Pathways of neurodegeneration - multiple diseases
    103740409 (Wnt9a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103740409 (Wnt9a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103740409 (Wnt9a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103740409 (Wnt9a)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103740409 (Wnt9a)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 103740409
NCBI-ProteinID: XP_008839249
LinkDB
Position
Un
AA seq 343 aa
MNVHGAMLHLLTGSEPLTILPLTLETEAAAQAHYKACDRLKLERKQRRMCRRDPGVAETL
VEAVSMSALECQYQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACS
AGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLV
GVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGSTTNEATG
EAGAISPPRGRASGSGGGDPLPRTPELVHLDDSPSFCLAGRFSPGTAGRRCHREKNCESI
CCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVYTCKG
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgaacgtgcatggggccatgctacacctgctgacaggcagtgagcccctgaccattctt
cctctgactctggagaccgaggcagcagcccaggcacactacaaggcctgtgaccggctg
aagctggaacgcaagcagcgccgcatgtgccgccgggacccaggtgtggctgagacactg
gtagaggctgtgagcatgagtgcacttgagtgccagtaccagttccgttttgagcgctgg
aactgcaccctggagggccgttaccgagccagcctgctcaagcgaggcttcaaggagacc
gccttcctctatgccatctcctctgcgggcctgacacatgcactggccaaggcatgcagt
gcaggccgcatggaacgctgcacgtgtgacgaggcacctgacctggagaaccgtgaagcc
tggcagtggggtggctgtggagacaacctcaagtatagcagcaagtttgtcaaggagttc
ctgggcaggcggtcgagcaaggatcttcgagcccgagtagacttccacaacaacctcgtg
ggtgtgaaggtgatcaaggctggggtggagaccacctgcaaatgccatggcgtgtctggc
tcctgcacagtgcggacctgctggcggcagctagcgcccttccacgaggtgggcaagcac
ctgaaacacaagtatgagacggcacttaaggtgggcagcactaccaatgaagctaccggc
gaggcaggcgccatctccccaccacggggccgggcctcagggtcaggaggtggtgatcca
ctgccccgaacaccagagcttgtacacctggatgactctcccagcttctgcctggctggc
cgcttctcccctggcactgcaggccgcaggtgccaccgtgagaaaaactgtgagagtatt
tgctgtggccgtggccacaacacacagagccgggtggtaacaaggccctgccagtgccag
gtacgctggtgctgctatgtggagtgcaggcaatgcacacagcgagaggaggtctacacc
tgcaagggctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743015
Entry
103743015         CDS       T03372                                 

Gene name
Wnt11
Definition
(RefSeq) Wnt family member 11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103743015 (Wnt11)
   04390 Hippo signaling pathway
    103743015 (Wnt11)
   04150 mTOR signaling pathway
    103743015 (Wnt11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103743015 (Wnt11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103743015 (Wnt11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743015 (Wnt11)
   05205 Proteoglycans in cancer
    103743015 (Wnt11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103743015 (Wnt11)
   05226 Gastric cancer
    103743015 (Wnt11)
   05217 Basal cell carcinoma
    103743015 (Wnt11)
   05224 Breast cancer
    103743015 (Wnt11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103743015 (Wnt11)
   05022 Pathways of neurodegeneration - multiple diseases
    103743015 (Wnt11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103743015 (Wnt11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103743015 (Wnt11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103743015 (Wnt11)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103743015 (Wnt11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103743015
NCBI-ProteinID: XP_008842451
LinkDB
Position
Un
AA seq 354 aa
MKARPQVCEALLFALALHTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMRTIVHAAREAMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLETKCKCHGVSGSCSIRTCWKGLQELWDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaaggcgcggccgcaggtctgcgaggcgctgctcttcgccctggctctccacactggc
gtgtgctatggcatcaagtggctggctctatccaagacgccggcagccctggcgctcaac
cagacgcagcactgcaaacagctagagggcttggtgtctgcgcaggtgcagctctgccgc
agcaacctggagctcatgcgtaccatcgtgcacgctgctcgggaggccatgaaggcctgc
cgcagggccttcgctgacatgcgctggaactgctcttccatcgagctcgcccccaactac
ctgcttgacttggagagaggtacccgggaatcagccttcgtgtatgcgctgtcggccgct
gccatcagccacgccatcgcccgggcctgcacctctggcgacctgcccggctgctcctgc
ggccctgtcccaggtgagccacccgggcctgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgtgcctccctggaaacgaagtgtaagtgccatggagtgtctggctcctgctccatc
cgcacctgctggaaggggctacaggagctctgggatgtggctgccgacctcaagacccgc
tacttgtcagccaccaaggtggtgcaccgacccatgggcacccgcaaacacttggttccc
aaagacctggatatccggcctgtgaaggactcagaactggtctatctgcagagttcacct
gacttctgtatgaagaatgagaaggtgggctcccacgggacccaagacaggcagtgcaac
aagacctccaatggcagcgacagctgcgacctcatgtgctgtgggcgcggctacaacccc
tacacagaccgcgtggtggagcggtgccactgcaagtaccactggtgttgctatgtcacc
tgccgcaggtgtgagcgcacagtggaacgttatgtctgcaagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743417
Entry
103743417         CDS       T03372                                 

Gene name
Wnt7b
Definition
(RefSeq) Wnt family member 7B
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103743417 (Wnt7b)
   04390 Hippo signaling pathway
    103743417 (Wnt7b)
   04150 mTOR signaling pathway
    103743417 (Wnt7b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103743417 (Wnt7b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103743417 (Wnt7b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743417 (Wnt7b)
   05205 Proteoglycans in cancer
    103743417 (Wnt7b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103743417 (Wnt7b)
   05226 Gastric cancer
    103743417 (Wnt7b)
   05217 Basal cell carcinoma
    103743417 (Wnt7b)
   05224 Breast cancer
    103743417 (Wnt7b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103743417 (Wnt7b)
   05022 Pathways of neurodegeneration - multiple diseases
    103743417 (Wnt7b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103743417 (Wnt7b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103743417 (Wnt7b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103743417 (Wnt7b)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103743417 (Wnt7b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103743417
NCBI-ProteinID: XP_008842908
LinkDB
Position
Un
AA seq 353 aa
MLLLSPRSALLSVYCPQIFLLLSSGSYLALSSVVALGANIICNKIPGLAPRQRAICQSRP
DAIIVIGEGAQMGIDECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVA
HAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNA
RRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAV
QVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNR
TSQGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgctcctcctgtcgccgcggagcgcgcttctctccgtctattgcccgcagatctttctc
ctcctgtccagcggcagctacctagcactgtcatccgtggtagccctgggagccaacatc
atctgcaacaagattcctggcctggccccgcggcagcgtgccatctgccagagccgaccc
gatgccatcatcgtgatcggggaaggggcgcagatgggcattgatgagtgccagtatcag
ttccgctttggccgctggaactgctccgccctgggcgagaagaccgtcttcgggcaagag
ctccgagtagggagccgtgaggccgctttcacatatgccatcaccgcagcaggcgtggca
catgcagtcacggccgcctgcagccagggcaacctgagcaactgtggctgtgacagggag
aagcaaggctactacaatcaggcggagggctggaagtggggcggctgctcagctgatgtg
cgatacggcatcgacttctcccggcgcttcgtggatgcccgagagatcaagaagaacgcc
aggcgcctcatgaatctccacaacaacgaggcgggcaggaaggttctggaggaccgcatg
aagctggagtgtaagtgtcacggcgtgtcgggctcctgtaccaccaaaacctgctggacc
acgctgcccaagttccgagaggtgggtcacctgctcaaggaaaagtacaacgccgccgtg
caggtagaggtggtccgtgccagccgcctgcggcagcccaccttcctgcgcatcaaacag
ctgcgcagctaccagaagcccatggagacggacctggtgtacatcgagaagtcacctaac
tactgtgaggaggacgcggccacgggcagcgtgggcacacagggccgcctgtgcaaccgc
acctcgcagggtgccgatggctgcgacaccatgtgctgcgggcgcggctacaacacgcac
cagtacacaaaagtgtggcagtgtaactgcaaatttcactggtgctgcttcgtcaagtgc
aacacgtgcagcgagcgcaccgaggtcttcacctgcaagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743982
Entry
103743982         CDS       T03372                                 

Gene name
Wnt8b
Definition
(RefSeq) Wnt family member 8B
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103743982 (Wnt8b)
   04390 Hippo signaling pathway
    103743982 (Wnt8b)
   04150 mTOR signaling pathway
    103743982 (Wnt8b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103743982 (Wnt8b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103743982 (Wnt8b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743982 (Wnt8b)
   05205 Proteoglycans in cancer
    103743982 (Wnt8b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103743982 (Wnt8b)
   05226 Gastric cancer
    103743982 (Wnt8b)
   05217 Basal cell carcinoma
    103743982 (Wnt8b)
   05224 Breast cancer
    103743982 (Wnt8b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103743982 (Wnt8b)
   05022 Pathways of neurodegeneration - multiple diseases
    103743982 (Wnt8b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103743982 (Wnt8b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103743982 (Wnt8b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103743982 (Wnt8b)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103743982 (Wnt8b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103743982
NCBI-ProteinID: XP_008843776
LinkDB
Position
Un
AA seq 329 aa
MSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSAN
RETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAI
SKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFR
EVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTL
GLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVHCE
QCRRRVTKYFCSRAERPPRGAAHKPGRKP
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtcagtgaacaattttctgatgactggtccaaaggcttacctgatctactccagtagt
gtggcagctggtgcgcagagtggaattgaagaatgtaaataccagtttgcctgggaccgc
tggaactgccctgagagagccttacagctgtcgagccatggtggacttcgcagtgctaat
cgggagacagcgtttgtacacgccatcagctctgctggggtcatgtacaccctgactaga
aactgcagccttggagattttgacaactgtggctgtgatgactcccgcaatggacaactg
gggggccaaggctggctgtggggaggctgcagtgataacgtgggtttcggagaggccatt
tccaagcagtttgtggatgccctggagacaggacaggatgcccgggcagccatgaatctg
cacaacaatgaggctggccgcaaggcggtgaagggaaccatgaaacgcacgtgcaagtgc
cacggcgtgtccggcagctgcaccacgcagacctgctggctgcagctgccggagttccgc
gaggtgggcgcgcacctgaaggagaagtatcacgcggcgctcaaggtggacctgctgcag
ggtgcgggcaacagcgcggcgggtcgcggcgccatcgccgacaccttccgctccatctcc
acgcgcgagctggtgcacctggaggactccccagactactgcctggagaacaagactcta
gggctgctgggcaccgagggccgcgagtgcctgcgtcgcgggcgagcgctgggccgctgg
gagcgtcgcagctgccgccggctgtgcggggactgcgggctggctgtggaggagcgccgc
gccgagaccgtgtccagctgcaactgcaagttccactggtgctgcgcggtccactgcgag
cagtgccgccggcgggtcaccaagtacttctgcagccgcgcagagcggccgccgagaggc
gccgcacacaaacctggaaggaaaccctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746395
Entry
103746395         CDS       T03372                                 

Gene name
Wnt4
Definition
(RefSeq) Wnt family member 4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04919  Thyroid hormone signaling pathway
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103746395 (Wnt4)
   04390 Hippo signaling pathway
    103746395 (Wnt4)
   04150 mTOR signaling pathway
    103746395 (Wnt4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103746395 (Wnt4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103746395 (Wnt4)
   04916 Melanogenesis
    103746395 (Wnt4)
  09158 Development and regeneration
   04360 Axon guidance
    103746395 (Wnt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746395 (Wnt4)
   05205 Proteoglycans in cancer
    103746395 (Wnt4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103746395 (Wnt4)
   05226 Gastric cancer
    103746395 (Wnt4)
   05217 Basal cell carcinoma
    103746395 (Wnt4)
   05224 Breast cancer
    103746395 (Wnt4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103746395 (Wnt4)
   05022 Pathways of neurodegeneration - multiple diseases
    103746395 (Wnt4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103746395 (Wnt4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103746395 (Wnt4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103746395 (Wnt4)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103746395 (Wnt4)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103746395
NCBI-ProteinID: XP_008846777
LinkDB
Position
Un
AA seq 296 aa
MCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAI
SSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRER
SKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALK
EKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDIRSGVLGTRGRT
CNKTSKAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR
NT seq 891 nt   +upstreamnt  +downstreamnt
atgtgcaagcggaatctggaggtgatggactcggtgcgccgtggcgcccagttggccatt
gaggagtgccagtaccagttccggaaccggcgctggaactgctccacacttgactccctg
cccgtctttggcaaggtggtgactcaagggactcgggaggcggcgtttgtgtatgccatc
tcttcagcaggtgtagcctttgcggtaacaagggcgtgcagcagtggagaactggaaaag
tgtggctgtgaccggacggtgcatggggtcagcccacagggcttccaatggtcaggatgc
tcggacaacatcgcctatggtgtggccttctcacagtcctttgtggacgtgcgggagaga
agcaagggggcctcctctagccgggccctcatgaaccttcacaacaacgaggctggcagg
aaggccatcctgacacacatgcgggtggaatgcaagtgccacggggtgtcaggttcctgt
gaggtaaagacatgctggcgagcagtaccgcccttccgccaagtgggccatgcactgaag
gagaagtttgatggggccaccgaagtggaacctcgccgtgtaggctcctccagggcactg
gtgccacgtaacgcacagttcaagccacatacagatgaggacctggtgtacctggagccc
agcccggacttctgtgagcaggacatacgcagtggtgtgctgggcacgagaggccgtaca
tgcaacaagacgtctaaggccattgacggctgcgagctgctgtgctgcggccgtggcttc
cacacggcacaggtagagctggctgaacgctgcagctgcaagttccattggtgctgcttc
gtcaaatgccgccagtgccagcgacttgtggagctacacacgtgccggtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103749032
Entry
103749032         CDS       T03372                                 

Gene name
Wnt5a
Definition
(RefSeq) Wnt family member 5A
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103749032 (Wnt5a)
   04390 Hippo signaling pathway
    103749032 (Wnt5a)
   04150 mTOR signaling pathway
    103749032 (Wnt5a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103749032 (Wnt5a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103749032 (Wnt5a)
  09158 Development and regeneration
   04360 Axon guidance
    103749032 (Wnt5a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103749032 (Wnt5a)
   05205 Proteoglycans in cancer
    103749032 (Wnt5a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103749032 (Wnt5a)
   05226 Gastric cancer
    103749032 (Wnt5a)
   05217 Basal cell carcinoma
    103749032 (Wnt5a)
   05224 Breast cancer
    103749032 (Wnt5a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103749032 (Wnt5a)
   05022 Pathways of neurodegeneration - multiple diseases
    103749032 (Wnt5a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103749032 (Wnt5a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103749032 (Wnt5a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103749032 (Wnt5a)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103749032 (Wnt5a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103749032
NCBI-ProteinID: XP_008850059
LinkDB
Position
Un
AA seq 360 aa
MCSKFLLMALAIFFSFAQVEIEANSWWSLGVNNPVQMSEVYIIGAQPLCSQLAGLSQGQK
KLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYA
VSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDAR
ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFR
KVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGT
QGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtgttccaagttcctcctaatggctctggccatatttttctccttcgcccaggttgaa
atcgaagctaattcttggtggtccctaggtgtgaataaccctgttcagatgtcagaagta
tatatcataggcgcacagcctctttgcagccaactggcaggactgtctcaaggacagaag
aaactgtgccacttgtatcaggaccacatgcagtacattggagaaggtgcgaagacgggc
atcaaagaatgccagtaccagttcaggcatcggagatggaactgcagcacggtggataac
acctctgtctttggcagggtgatgcagataggcagcagagagacggccttcacttacgcc
gtgagtgccgcgggagtggtgaatgccatgagccgagcttgccgagagggcgagctgtct
acttgcggctgcagtcgggctgcgcgccccaaggacctgccgcgggactggctgtggggt
ggctgcggcgacaacatagactatggctaccgcttcgccaaggagttcgtggacgcacgt
gagcgggagcgcatccacgccaagggctcctatgagagcgcacgcatcctcatgaacctg
cataacaacgaggcaggccgaaggacggtgtacaacctggcagacgtagcctgcaagtgc
catggggtgtccggctcatgtagcctcaagacgtgctggctgcagctagcggacttccgc
aaggtgggggatgccctcaaggagaagtatgacagcgcagcagccatgcggctcaacagc
aggggcaagctggtgcaggtcaacagccgcttcaactcgcccaccacgcaggacctggtc
tatatcgacccgagtccggactactgcgtgcgcaatgagagcacgggctcgctgggcaca
cagggccgcctgtgcaacaagacatcggagggcatggatggctgcgaactcatgtgctgt
ggccgaggctatgaccagttcaagacagtgcagaccgagcgctgccactgcaagttccac
tggtgctgctatgtcaagtgcaagaagtgcacggagatcgtggaccagttcgtgtgcaaa
tag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750565
Entry
103750565         CDS       T03372                                 

Gene name
Wnt10b
Definition
(RefSeq) Wnt family member 10B
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103750565 (Wnt10b)
   04390 Hippo signaling pathway
    103750565 (Wnt10b)
   04150 mTOR signaling pathway
    103750565 (Wnt10b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103750565 (Wnt10b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103750565 (Wnt10b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103750565 (Wnt10b)
   05205 Proteoglycans in cancer
    103750565 (Wnt10b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103750565 (Wnt10b)
   05226 Gastric cancer
    103750565 (Wnt10b)
   05217 Basal cell carcinoma
    103750565 (Wnt10b)
   05224 Breast cancer
    103750565 (Wnt10b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103750565 (Wnt10b)
   05022 Pathways of neurodegeneration - multiple diseases
    103750565 (Wnt10b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103750565 (Wnt10b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103750565 (Wnt10b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103750565 (Wnt10b)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103750565 (Wnt10b)
SSDB
Motif
Pfam: wnt DUF5586
Other DBs
NCBI-GeneID: 103750565
NCBI-ProteinID: XP_008851892
LinkDB
Position
Un
AA seq 389 aa
MLEEPRSRPPPSGLAGLLFLALCSRALSNEILGLKVPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLEALSRGKSFPHSVPSP
VPGSGPNPGPQDTWEWAGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLSRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTVGSPGTRGRVCNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgctggaggagccccggtctcgacctccgccctcgggcctcgcgggtctcctgttcttg
gccttgtgcagtcgggctctaagcaatgagattctgggcctgaaagttcctggtgagccg
ccgctgactgccaacaccgtgtgcttgaccctgtcgggtttgagtaagcgacagctaggc
ctgtgtctacgcagccccgacgtgacggcgtcggcgcttcagggtctgcacatcgcggtt
cacgagtgtcagcaccagcttcgggaccagcgctggaactgctctgccctggagggcggt
ggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgtgagagtgctttctcc
ttctccatgctggctgctggggtcatgcatgctgttgccacagcctgcagcctgggcaag
ctggtgagctgtggctgcggctggaagggcagtggtgagcaggaccggcttcgagccaaa
ctgctgcagctggaggcactgtcccggggcaagagttttccccactcagtgcccagccct
gtccctggttctggccccaatcctggcccccaggacacatgggaatgggctggctgtaac
catgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
agggacatccaggcacgaatgcgaatccacaacaacagggtggggcgccaggtggtaacc
gaaaacctgaagcggaagtgcaagtgtcatggcacatcaggcagctgccagttcaagaca
tgctggagggcagcccctgagttccgagctgtaggggcagcactgagagagcggttgagc
agagccatcttcatcgatacccataaccgcaattctggagctttccagccccgcctgcga
ccccgtcgcctctcaggagagctggtctactttgagaagtccccagacttctgtgagagg
gaccccacggtgggctccccaggcacaagaggccgggtctgcaacaagaccagccgcctg
ttggatggctgtggcagcctgtgctgtggccgagggcacaacgtgctccgacagacacga
gttgagcgctgccattgccgtttccactggtgctgctatgtgctgtgtgatgagtgcaaa
gtcacagaatgggtcaatgtgtgtaagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750567
Entry
103750567         CDS       T03372                                 

Gene name
Wnt1
Definition
(RefSeq) Wnt family member 1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103750567 (Wnt1)
   04390 Hippo signaling pathway
    103750567 (Wnt1)
   04150 mTOR signaling pathway
    103750567 (Wnt1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103750567 (Wnt1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103750567 (Wnt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103750567 (Wnt1)
   05205 Proteoglycans in cancer
    103750567 (Wnt1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103750567 (Wnt1)
   05226 Gastric cancer
    103750567 (Wnt1)
   05217 Basal cell carcinoma
    103750567 (Wnt1)
   05224 Breast cancer
    103750567 (Wnt1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103750567 (Wnt1)
   05022 Pathways of neurodegeneration - multiple diseases
    103750567 (Wnt1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103750567 (Wnt1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103750567 (Wnt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103750567 (Wnt1)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Morphogens
   103750567 (Wnt1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 103750567
NCBI-ProteinID: XP_008851894
LinkDB
Position
Un
AA seq 370 aa
MGFWTLLPSWVSAMLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggttctggacgctgctgcccagctgggtttctgctatgttgctactggcactggcc
gctctgcccgcagccctggccgccaacagcagtggccgatggtggggcatcgtaaatgta
gcctcctccacgaatctgctgacggactccaagagtctgcaactggtgctagagcccagt
ctgcagttgctgagccgcaaacagcggcggctgatccgccagaacccggggatcctgcac
agcgtgagcggagggctgcagagcgcagtgcgcgagtgcaagtggcagttccggaaccgc
cgctggaactgccctactgctcccgggccccacctcttcggcaaaatcgtcaaccgaggc
tgccgggaaacagcgtttattttcgccatcacctccgccggggtcacacattcggtggcg
cgctcctgctccgagggctccatcgagtcttgcacttgtgactaccgccggcgcggcccc
ggggggcccgactggcactggggaggttgcagcgacaacatcgatttcggccgcctcttt
ggccgagagttcgtggactctggggagaaggggcgggacctgcgctttctcatgaacctg
cacaacaacgaggctggccgcacgaccgtgttctctgagatgcgccaggagtgcaagtgc
catgggatgtctggctcgtgcaccgtgcgcacgtgctggatgcggctgcccacgctgcgt
gctgtcggtgacgtgctgcgcgaccgcttcgacggcgcctctcgagtcctctatggcaac
cgcggtagcaaccgcgcttcccgggccgagctgctgcgcctggagcccgaagaccctgcg
cacaagccgccctcccctcacgacctcgtctacttcgagaaatcgcccaacttctgcacg
tacagcggacgcttgggtacggcgggcacggcagggcgtgcttgcaacagctcttctcct
gcgctggacggctgcgagttgctctgctgtggccggggccaccgcacgcgcacgcagcgc
gtcactgagcgttgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcatgagtgtttgtga

DBGET integrated database retrieval system