KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724791Help
Entry
103724791         CDS       T03372                                 

Gene name
Mgam2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00052  Galactose metabolism
ngi00500  Starch and sucrose metabolism
ngi01100  Metabolic pathways
ngi04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103724791 (Mgam2)
   00500 Starch and sucrose metabolism
    103724791 (Mgam2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103724791 (Mgam2)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     103724791 (Mgam2)
    3.2.1.20  alpha-glucosidase
     103724791 (Mgam2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103724791
NCBI-ProteinID: XP_017650799
LinkDB All DBs
Position
Un
AA seq 2117 aa AA seqDB search
MAKKLNILEVLLIIFNIILLALDIILLLLVLEKPSDSSFTPECPDISESERIDCAPGQVV
TEDVCRWQHKCCWKPVADTSVPRCFFPRNWGYEVTNVQTNTSTGLTALLKKLPSPPLFGN
DITNALFTANYETANRFHFKVTDYNEKRYEVPHENIQLFNATADDSSLNYYIEVIKKPFS
MRIMRKSNKRVLLDTSIGPLHFAQQYLQLSFRLPSSNVYGLGEHVHQQYRHSMSWNTWPI
FTRDTTPTEGTINLYGAHTFFLCLEDTSGASFGVFLMNSNAMEATLQPAPAITYRTTGGI
LDFYVFLGNSPEQVVQEYLEVVGRPFLPSYWSLGFQLSRRDYGGIDRLKEVVDRNRKAEI
PYDVQYSDIDYMSGKKDFTIDEQAYPELSKFATELHNNGQKYVIIMNPGILKDPAYQTYS
NGSISRVWILDTNGFAVGEGYPGQSVFPDFSNPASIPWWTQQLAEFYKHLEFDGVWIEMD
EVSTLQDPDKKCESNNLNFPPFTPNVLGGSLFTRTLCMDTEFYSGLHYDVHSLYGYNMAR
VTDLALESVLSAKRNFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIP
MVGANICGYFKDVTEELCARWMQLGAFYPLSRNHNGPEFRDQDPAAFGTDSWLLKSSRHY
LNIRYTLLPYLYTLFYRAHTLGETVARPLVHEFFQDPATWDIHEQFLWGPGLLITPVLYE
GMDQVKAYIPDAIWYDYETELVIQWRKQFVDMQLPREKIGLHLRGGYIFPIQQPNITTEA
SRERPLRLIVALDHKREAKGELYWDDGVSKGSVTGKKYILYEFSVTSNSFQAKIVNNGYE
DPNNLTFTDIRILGMDKEPTDFTVLVNNNPASLSNFVYNASTKVVTITNLPGLKLGQEFS
IQWKLGVSDLEKFNCYPEDPTASEESCRQRGCLWEYTTTPGVPSCFYDTIPQYAANNIQY
QPTGITMDLTLLEDSASARSAQAPRASDPLSGKISSLRLSVTYHTESMLQVKIYDPTNQR
YEVPIALNTPPSPLGSSENCLYDVEVKTNPFGIQIRRKNSSTVIWDSQVPGFTFSDMFIS
IATRLPSQYLYGFGETEHTAFRRNMSWNMWGMFARDEPPVNKKNSYGVHPYYLALEKDGS
AHGVLLLNSNAMDVTLQPTPALTYRTIGGILDFYMVLGPTPELVTQQYTELIGRPAMTPY
WSLGFQLSRYGYRNDAEIASLYDAMMAAGIPYDVQHVDIDYMDRKLDFTLSPSFQNLSHV
IDEMKTNGMRFILVLDPAISGNETHYLTFTRGQEKNVFIKWPDTNDIVWGKALPELPNVN
VDESLDHETQVKMYKAYVAFPDFLRTSTAAWWKKEIEELYTNPWEPEKSLKFDGLWIDMN
EPSNFVDGSVGGCRSEILNNPPYMPYLESRDKGLSSKTLCMEGEQILPNGSHMRHYDVHS
LYGWSQTRPTYEAVQEVTGQQGIIITRSTFPSSGRWGGHRLGENTAAWDQLGKSIIGMME
FSLFGIPYTGADICGFFGNAEYEMCIRWMQLGAFYPFSRNHNTAGTRRQDPVSWDSDFEA
YSRKVLHTRYTLLPYLYTLMHKAHTEGSTVIRPLLHEFTNDSVTWDIDRQFMLGPAILIS
PVLESNTFEINAYFPQALWYDYSTESGQESKGEWKALKAPLDHINLHVRGGYILPWQEPT
INTHFSRQNYMGLTVALDGNEKAEGQMFWDDGQSIDTYENGDYFLAHFTAAQNTLKIQVI
HNQYLSDSNPLKVGYIRIWGLDSSYVVQVRLIYNNQQVMETNFMSDPYNQTLTIHLTEKS
ISLEKLTEVTWVFGVPTLPTPITTSISPTSFPPFPSSTEATSADTTTSSANITTPNVTST
VVVTTTPEISTTNVTSSTLPPNVTTPFSMSPTTINTSPTFPNTTTTPEISTVDVTTNTTL
LNITTTSPMSPTIDSTSPTFPYTTTTPEISTNTTLPNITTAFPTSPTIGNTSSFPVITTI
SEISTVDVTTNTTLPNITTTSPMSPTIDSTSSTFPNTTTTPEISTVDVTTNTTLPNITTP
SPMSPPIDTTSPTFPNTTTTPEINSQEWSTLNFIILQECKGDEVIASQIPSMPYQSWRKD
CSTRKQDYDVRPQPSEL
NT seq 6354 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaagctaaacatattggaagtccttctgatcattttcaatataattttattg
gcattggatatcattttgctgcttcttgtgctagagaaaccttcagattcttcatttact
cctgagtgtccagacatctctgagtcagaaaggatagactgtgctcctggccaggtggtg
acagaggatgtctgcagatggcagcataaatgttgctggaaaccagtggcagataccagt
gtccctaggtgcttcttccctaggaactggggttatgaagtcaccaatgtacaaacaaat
acaagcacagggttgactgccctgctgaaaaagttgccatccccgcctttgtttggaaat
gatattactaatgccctcttcactgctaactatgagacagccaatcgttttcattttaag
gtcaccgattacaatgagaaacgctatgaagtccctcatgaaaacatccagttgtttaat
gcgactgctgatgattccagtttaaactactacatagaggtcatcaagaaacccttcagc
atgcggataatgcggaagagcaacaaaagagtcttgttagacaccagcatagggcccctt
cactttgcccagcagtacctgcagctgtctttccgactacctagctccaatgtgtatggg
ctgggagagcacgtgcatcaacaataccgccatagcatgagctggaatacctggcccatc
ttcacccgagacaccactcccacagagggcacgattaatctgtatggagcacacacattc
ttcttgtgccttgaagacaccagtggggcctcttttggagtttttctgatgaacagtaat
gccatggaggccaccctccaacctgctcctgccatcacttaccgcacaactgggggcatt
cttgacttttatgtcttcttgggaaacagtccagagcaggtggttcaggaatacctggag
gttgttggacgaccatttttgccttcgtactggagtcttggtttccagcttagtcgtagg
gattacggtggcattgacaggctgaaggaggttgtagatcgaaaccgtaaagctgagatc
ccatatgatgtacaatattcagacatagactacatgagtggaaagaaagatttcaccatt
gatgaacaggcttatcccgagctctcaaagtttgcaacagaattacataacaatggacag
aagtatgtaattattatgaaccctggcatcttgaaagatcctgcctatcagacctacagt
aatggaagcataagccgagtgtggatcttggacaccaatggctttgctgttggggagggt
tatcctggacagtcagtcttccccgacttcagcaatccagcctcgattccatggtggacc
cagcagctcgctgaattttataaacatctggagtttgatggcgtatggattgaaatggat
gaagtatctaccctccaagatcctgataaaaaatgtgaatcaaacaacttgaacttccct
cctttcactcctaacgtcctgggtggctctctgtttacaaggaccctctgcatggacaca
gaattctactcaggccttcactacgatgtccacagcttgtatggctacaacatggcgaga
gtcacagacttggccctggagtctgtcttgtctgctaagaggaactttatcttatcccgt
tctacctttgctggatctggaaaatttgctgctcactggctgggggacaatgcagctacc
tgggatgacctcagatggtccatccccagcatccttgagttcaacctgtttggcatcccc
atggtaggtgccaacatctgtggctattttaaagatgtcacagaggagctctgcgcaagg
tggatgcagcttggagcattttatccactgtccagaaatcacaatggtcctgagttcaga
gaccaggaccctgccgcctttggaactgactcttggctgttaaaatcctccagacattat
ctgaacatccgctataccttgctgccttatctctacacccttttctaccgtgctcacacc
ctgggagagacggtagcaagacctctggtacatgagttctttcaggacccagccacgtgg
gacatacatgagcagttcttatggggacctggactcctaatcacacctgtgctatatgaa
ggcatggaccaagtgaaagcctacatcccagatgccatttggtatgactacgagacagaa
ctagtcatccaatggaggaaacaatttgtggatatgcaactcccaagagaaaagattggc
cttcaccttcgagggggttacatatttcccatccagcagccaaacataaccacagaggcc
agccgggaacgtcccctgagactcattgttgccttggaccacaagagagaagcgaaggga
gaactgtactgggacgacggtgtgtctaaaggctcagtaactggaaagaaatacattctg
tacgagttttctgttacatctaattctttccaggcaaagattgtaaataatggttatgag
gaccccaataacctcacgtttacagacatcagaatcttggggatggacaaggagccgact
gattttactgtcttagtgaataataatcctgcatccctttcaaatttcgtctacaatgcc
tcaacgaaggtggtgactatcactaacctcccaggactgaaactgggacaagaattctcc
atccagtggaaacttggcgtcagtgacctagagaagtttaattgctatcccgaggatcct
acagcctccgaggagagctgcaggcaacgagggtgcctctgggagtacacaactactccc
ggcgtgccctcctgtttctatgacaccattcctcagtatgctgccaacaacattcagtac
cagcccacaggcatcaccatggacctaaccctcctggaagactcagcatctgcaagatca
gcacaagctcctcgtgcctctgatcctctctctgggaagatcagctctcttaggctgagt
gtgacctaccatacagaaagcatgctgcaggtcaagatctacgaccccactaatcaaaga
tatgaggttccaatagctctgaataccccaccttcaccgctcggctcctctgaaaactgc
ctgtatgatgttgaggttaagaccaacccttttggaatccaaattcgacggaaaaactcc
agcactgtgatttgggattctcaagtccctggcttcaccttcagtgacatgttcatttcc
attgcaactcgcctcccttctcagtacctctatggctttggggaaactgagcacacagct
ttcagaagaaacatgagttggaacatgtggggaatgtttgctcgagatgagccgccggtg
aataagaaaaattcctatggtgtccatccctattatttggcattggaaaaagatggtagt
gcccatggagtactcctgttgaacagcaatgccatggatgtgacgctccagcccacccca
gccctgacataccgcaccataggagggattttggacttttatatggttcttgggccaaca
cctgaacttgtaacccagcagtacactgagttgattggtcggccagcaatgactccatac
tggtccctgggtttccagctgagtcgctatggatatcgaaatgatgctgaaatagccagt
ttgtatgatgcaatgatggcagctgggattccctatgatgtccagcatgtagacattgat
tacatggaccggaagctggacttcaccctcagccccagctttcaaaacctcagtcatgta
attgacgaaatgaagacaaatggcatgagatttattcttgttctggacccagccatttct
ggcaatgagacacactatctcacattcactagaggacaagaaaagaacgtgttcatcaaa
tggcctgacaccaatgacattgtctggggaaaggctttgccagagctgcccaatgtgaat
gtggatgaatcccttgaccatgagactcaggttaagatgtacaaggcctatgttgctttt
cctgatttcctgcgtaccagcacagctgcatggtggaagaaggagatagaagagctctat
acaaacccttgggagccagagaagagcttgaaattcgatggcctgtggattgacatgaat
gaaccatcaaactttgtggatggatctgttgggggctgccgcagtgagattcttaataac
ccgccttacatgccatatttggaatccagggataaaggtttgagcagcaagaccctgtgc
atggagggtgagcagatcctgcctaacggctcccacatgcggcactacgatgtgcacagc
ctgtacgggtggtcccagactagacccacctacgaagctgtgcaggaggtgacaggacag
caaggcatcatcatcacccgctccacgttcccctcttctggccgctggggaggacaccgg
ctgggagagaacacagctgcctgggaccagctggggaaatctatcattggcatgatggag
ttcagtctctttggaataccgtatacaggagcagacatttgtgggttcttcggaaatgct
gaatatgagatgtgtattcgctggatgcaattgggagcattttatccattttccaggaat
cataacactgctgggaccaggagacaagatcctgtgtcctgggattcagactttgaggca
tactcaagaaaagtgctgcatactagatacaccctgctgccttacctctacaccctgatg
cataaagctcacacagaggggagcactgtcatccgaccacttctccatgagttcactaat
gacagtgtgacgtgggatatagaccgtcagtttatgttgggcccagccatccttatcagc
cccgtgctggaaagtaacacttttgagatcaatgcttatttcccacaagccctgtggtat
gactatagcacggaatcaggccaagagtccaaaggtgagtggaaagcactgaaggctcct
ctggaccacatcaaccttcatgtcagaggaggctacatcctgccttggcaggagcctaca
ataaatactcacttcagccgacaaaattatatgggattgactgttgctttggatggtaat
gagaaggctgaaggtcagatgttttgggatgatggacaaagtattgatacctatgaaaat
ggggactatttcttagcccactttacagcagcacagaacaccttaaaaatccaggtcata
cataatcaatatctgagcgactcaaacccactgaaagttggatatattagaatctggggt
ttagactcttcttatgtcgtccaagtcaggctcatctacaacaaccagcaggtcatggag
accaatttcatgagtgatccctacaatcagacactaactattcacctgactgaaaagagt
atcagcctggaaaagctaactgaagttacttgggtgtttggagttcctacacttcctact
ccaattacaacgagcatctctcccacaagttttcccccatttccatccagtactgaggct
accagtgctgacaccaccacaagttctgctaacataacgacacccaatgtgacaagtact
gttgtggtcactaccactcctgaaataagtactactaatgtcacatctagtaccttacct
cctaatgtaactacgcccttctccatgagtcctactactattaacactagtccaacgttt
cctaacacaaccacaactcctgaaataagcactgttgatgttaccactaacaccacactg
ttgaatataactacaacttctcctatgagtcctactatagatagcaccagtccaactttt
ccttacacaaccacaactcccgaaataagtactaacaccacactgcctaatataactaca
gctttccctacgagtcctactataggtaacactagttcttttcctgtcataaccacaatc
tccgaaataagtactgttgatgttaccactaacaccacactgcctaatataactacaact
tccccaatgagtcctactatagacagcaccagttcaacttttcctaacacaaccacaact
cctgaaataagtactgttgatgttaccactaacaccacactgcctaatataactacacct
tcccctatgagtcctcctatagatactacgagtccaacttttcccaacacaaccacaact
cctgaaataaactctcaggaatggagcaccttgaattttatcatactccaagaatgtaaa
ggcgatgaggtcattgcttcccagattcccagtatgccttaccagtcctggaggaaggat
tgttccaccaggaagcaggattatgatgtcagaccacagccttcagagctgtga

DBGET integrated database retrieval system