KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724895
Entry
103724895         CDS       T03372                                 

Gene name
Ifngr1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04066  HIF-1 signaling pathway
ngi04217  Necroptosis
ngi04380  Osteoclast differentiation
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi05140  Leishmaniasis
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05164  Influenza A
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05200  Pathways in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103724895 (Ifngr1)
   04066 HIF-1 signaling pathway
    103724895 (Ifngr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103724895 (Ifngr1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103724895 (Ifngr1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103724895 (Ifngr1)
   04658 Th1 and Th2 cell differentiation
    103724895 (Ifngr1)
   04659 Th17 cell differentiation
    103724895 (Ifngr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103724895 (Ifngr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103724895 (Ifngr1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103724895 (Ifngr1)
  09172 Infectious disease: viral
   05164 Influenza A
    103724895 (Ifngr1)
   05168 Herpes simplex virus 1 infection
    103724895 (Ifngr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103724895 (Ifngr1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103724895 (Ifngr1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103724895 (Ifngr1)
   05140 Leishmaniasis
    103724895 (Ifngr1)
   05142 Chagas disease
    103724895 (Ifngr1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103724895 (Ifngr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103724895 (Ifngr1)
   04090 CD molecules [BR:ngi04090]
    103724895 (Ifngr1)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IFN receptor family
   103724895 (Ifngr1)
CD molecules [BR:ngi04090]
 Proteins
  103724895 (Ifngr1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 103724895
NCBI-ProteinID: XP_008820268
LinkDB
Position
Un
AA seq 472 aa
MIVLVLLMLSAEAGSRAETSTRDPELPTVPAPTSVLITSYNLNPVVCWEYPNISHTPVFS
VQVKNYWPGEWTDACTNIFDHCCNIYEQVHDPINSVWARVKARIGQKESDYSVSKDFTMC
RQGKIGPPRVDIKRREEQVTVDIFHPEVIVNGEVLGIMFDDDSVCHTFDYRVYVRRNRTG
DILFTKHVLKTQDCSETECQLNITVTSLDFEYCVSVEGISDSWELTTEKSKEACISLSHN
SIKGSVWIPIVAAFVLLFLIVIVGFAYWHLKKNPLKKQSMILPKSLLSVVRNATSETKPE
SKYISLITSCQPLVPENETVLSEEPLSPVTTPDNPGEAEHGEHSIETEVVIMEGSTSDLT
PDSPPTPIKRENSSPLSSNQSEPCTITLNSYHSRDGSDSGLVGSGSFISDSEFPPPNKPE
IKTEEQESTAVRKAPTSFGYDKPHVLVDVIVDGGEKESLIGYRLTARAKELS
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgattgtcctcgtcctcctgatgctgtccgcggaggccgggagcagagctgagacaagc
acccgggatccggagttgcccaccgtgcctgcaccaaccagtgttctaattacatcttat
aacttgaaccctgtcgtatgctgggaatacccaaacatttcacatacacctgtttttagt
gtacaggtaaagaactattggcctggagaatggactgatgcctgcaccaatatctttgat
cattgttgcaatatttatgaacaagttcatgatcctattaattctgtctgggccagagtt
aaagccaggattggacaaaaggaatctgactattcagtgtcaaaagattttactatgtgc
aggcaaggaaaaattgggccacccagagtggacatcaaaaggagagaagaacaggtcact
gttgacatatttcaccccgaggtcatcgtaaatggagaagtgttgggaatcatgtttgat
gacgacagtgtctgtcacacattcgattaccgtgtgtacgtgcgaaggaacagaactggt
gatatcctatttacaaagcatgtactcaaaacacaagattgcagcgagactgaatgtcag
ttaaacatcacagtcacctccctagacttcgagtactgtgtttcagtagaaggaatctca
gactcctgggaacttacaactgaaaaatcaaaggaagcctgcattagcctttcccataac
agcattaaaggttcagtttggattccaattgttgctgcttttgtgctgctcttcctaatt
gttatcgtgggatttgcatattggcatcttaagaagaatccacttaagaagcaaagcatg
atattacccaagtccttgctctctgtggtaaggaatgccacttcggagacaaaacctgaa
tcaaaatacatatcgctcatcacatcgtgccagcccctagtcccagaaaatgagacagtg
ctctccgaagagccactgtctccagtgacaactccagacaacccaggagaagcagaacat
ggagaacattctattgaaacagaagtggtgattatggaaggaagtacttctgacttgacc
cctgacagccctccaactccaataaagagagaaaattcttctcctctaagtagtaaccag
tcagaaccctgtaccatcaccttaaactcctatcactccagagacggttctgatagtggc
cttgtggggtcaggcagcttcatatctgactccgaatttcccccacctaataaacctgaa
ataaagacagaggaacaagaatccacagctgtgagaaaggcccccacctcgtttggttat
gataaaccacacgtgctggtagatgtgattgtggatgggggggagaaggagtctttgatt
gggtatagactcacagcacgtgccaaagaactgtcgtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724897
Entry
103724897         CDS       T03372                                 

Gene name
Il22ra2
Definition
(RefSeq) interleukin 22 receptor subunit alpha 2
  KO
K05139  interleukin 22 receptor alpha 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103724897 (Il22ra2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103724897 (Il22ra2)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL10/28 receptor family
   103724897 (Il22ra2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 103724897
NCBI-ProteinID: XP_008820269
LinkDB
Position
Un
AA seq 231 aa
MMPKLCFLGLLIKFFLTSGGETQPTHESLKPQKVRFQSRNFHNILRWQPGIMLAGNSSIY
FVQYKMYGQPQWKNKQECWGTPALYCDLTNETSDLREPYYGRVKAVLARTNSDWVMTPRF
TPWWETQIDPPAVTVTRVNASLLVVLHAPDLPYRGQNGSNESMENYYDLVYRVFKINKSV
GKEQKVYEGAQRVVETEVLTPRSSYCVVAEIYRPILDKRSQRSKEKCVQIP
NT seq 696 nt   +upstreamnt  +downstreamnt
atgatgcccaaactttgcttcctaggcctcctcatcaagttcttcttgaccagtggagga
gagactcagccaacccatgaatcgctgaaaccccaaaaggtccgatttcagtccagaaat
ttccacaatattttgcgctggcagcctgggatcatgctcgctggaaacagcagcatctac
tttgtgcagtataagatgtatggacagccacaatggaaaaataagcaggaatgttggggg
acaccagcactctattgtgaccttaccaatgaaacctcagacctgcgggagccttactac
gggagggtgaaagcagtattggctagaaccaactctgactgggtcatgactccacgcttc
accccatggtgggaaacacaaatagatcctccagctgtgactgtaaccagagttaatgca
tctttgctggtggttctccacgctccagatttgccatatagaggccaaaatggaagcaat
gaatctatggaaaattactatgacttagtataccgagttttcaaaattaacaagtcggta
ggaaaggagcagaaagtatatgaaggggctcagagagttgttgaaactgaagttctgaca
cctcgctccagctattgtgtagtggctgaaatataccgtcccattttagacaaaagaagc
cagagaagtaaagagaaatgtgtgcagattccatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724898
Entry
103724898         CDS       T03372                                 

Gene name
Il20ra
Definition
(RefSeq) interleukin 20 receptor subunit alpha
  KO
K05136  interleukin 20 receptor alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103724898 (Il20ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103724898 (Il20ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103724898 (Il20ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103724898 (Il20ra)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL10/28 receptor family
   103724898 (Il20ra)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac
Other DBs
NCBI-GeneID: 103724898
NCBI-ProteinID: XP_008820270
LinkDB
Position
Un
AA seq 501 aa
MKNVLQWNPPEDLHGAEVTYTVQYFIYGQKKWLSTSGCRNISRTYCDLSAETSDYEHQYY
AKVKAIWETNCSKWAETGRFYPFSETQIGPPQVALTTGENSISIVLTAPEKWKRHPKDNP
VSMQQIYSNLKYNVSVYNNKSKKMWSQCVTNNTVVLTWLEPNTLYCVHVESFVPGHPRLA
LPSQKQCVSTWEDQTSALKVKIIFCYVLPTSVIVFLFSVIVYSIYRYIHVGKEKHPANLI
LIYENEIDKRFFEPTEVIKINSITLNILDDSKMSQKDMSLLEESSDQSNLDDPEPSRNPE
PHLQKVEVPHLGYSSHLMDIFCDAAESLRDASLTQPEWLSRTMFTGMADTEYDVPTYFCR
GLEDHQLPGHAEAARQRKLSESQAALRNLGPQTLLCSYTPQLNDLHHLVQEHPGLEEGPE
EEPSTTLVDWDPRTGRLCIPSLPHFEQDPEGCEPYGCDQFSEQGLLSRLYENQAPNKLSE
ENENYIMQFMEEWGLHVQMEN
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaagaatgtcctacagtggaatccaccagaggatctacatggagcagaagttacatac
actgtacagtatttcatatatgggcagaaaaaatggctgagtacatccggatgcagaaat
atcagcaggacctactgtgatctttctgctgaaacttctgactatgaacaccaatattat
gccaaagttaaggccatttgggaaacaaattgttccaaatgggctgaaactggacgattc
tatcctttttcagaaacacaaattggcccaccacaggttgccctgactactggtgagaac
tccatctccattgtcctgacggcaccagagaagtggaagagacatcccaaagataatcct
gtttctatgcaacaaatatactccaacctgaagtacaatgtgtctgtatataacaataaa
tcaaaaaaaatgtggtcccagtgtgtcacaaacaacacagtggtgctcacctggctggaa
ccaaacactctgtactgtgtccatgtggagtccttcgtcccagggcaccctcgccttgct
ctgccttctcagaagcaatgtgtcagtacttgggaagatcaaacatcagcattgaaagtg
aaaatcatcttctgttatgttctgcccacatctgttattgtgtttcttttttctgtgatt
gtctactccatttaccgttacatccatgttggcaaagagaaacatccagccaatttgatt
ttgatttatgaaaatgaaattgacaaaaggttctttgagcctactgaagtaattaaaatt
aactctatcaccctcaatattttggatgattctaaaatgtctcaaaaggatatgagttta
ctggaagaaagcagtgatcagtccaaccttgatgatcctgagcccagcaggaacccagaa
ccccatctgcagaaggtggaggtgccacacttaggatactcttcgcatttgatggacatt
ttctgtgatgctgcagagagcctcagagatgcctccctaacccagcctgagtggctcagc
aggaccatgttcacaggaatggcagacactgaatatgatgtaccaacatacttctgcagg
ggccttgaagaccaccagctccctggacatgcagaggcagccagacaaaggaaattatct
gaatcacaggcagctttgagaaacttgggcccacagacgctgctgtgttcatacaccccc
cagctcaatgacttacaccacctggtgcaggagcatcccggcttagaagaggggccagag
gaagagccatccacaacattggtagattgggatcctcggactggcaggctgtgcatccct
tccttacctcactttgaacaggaccctgagggctgtgaaccttatgggtgtgaccagttc
tcagagcagggccttttgtctagactctatgagaatcaagcacccaacaagctgtcagaa
gaaaatgaaaactatatcatgcagtttatggaggaatgggggttacatgtacaaatggaa
aactaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726945
Entry
103726945         CDS       T03372                                 

Gene name
Il12rb1
Definition
(RefSeq) interleukin 12 receptor subunit beta 1
  KO
K05063  interleukin 12 receptor beta-1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi05200  Pathways in cancer
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103726945 (Il12rb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103726945 (Il12rb1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103726945 (Il12rb1)
   04659 Th17 cell differentiation
    103726945 (Il12rb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103726945 (Il12rb1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103726945 (Il12rb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103726945 (Il12rb1)
   04090 CD molecules [BR:ngi04090]
    103726945 (Il12rb1)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL6/12 receptor family
   103726945 (Il12rb1)
CD molecules [BR:ngi04090]
 Proteins
  103726945 (Il12rb1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 103726945
NCBI-ProteinID: XP_017651427
LinkDB
Position
Un
AA seq 721 aa
MYPKELPSRLLVDPMGLQETSQHLFILLLLGRLGASCTADRCCFAELPYLDEDSGSSSGP
RNLTCYRVFNTDHYECSWQYEGPVDGVTHFLRCCLSTEHCCYFSAGSSTLVQFSEQDGVH
VLSNVTLWVESQRANWTMKSQKITLQLFSWVKLDPPLGDINVSRSDGQIRMMWETSKDGA
EVQFRRGTPNSGWILGDCGPQDVSGLESCLCPSELNVAQKFQVRRRRRLPSGIPGGPWSS
WSGNVCVPPETLPQPKIKFLMEPLGQDGRRRLTVQGQSLQPDLPENCQDVMPGGQVTHLV
HMRMLSCPCQPWTSRTVKLGKTLHISGAAYDMVVVAQTRFARSPIQTWHLPAQEFSALGP
LNISQEGNRTSLHWAAQAPGTAYCIEWQLDSQDRSHDNCTLTAPEDKVPAGMAAHTWSPE
PGAMKEDCYRVTIFASLRPDTLSSWSTVLSGYYFGGNASVAGRPQRVSVKNYSGDSVSLE
WTPSQLSTCPGVLKQYVVRWEAEDSEPVSERLLPPTETQVTLQGLRTGVVYTVQVRADTE
WLPGAWSQPQRFSFELQISRLSIVFASLGSFASVLLVGVLGYRGLNRAAWHLCPPLPTPC
ASTALEFPGIQGKQTWQWSSPGDFPEVLWPQEMLVVEMPWDRNDQTEPAQACPEPTVDLE
PSLQQDAVLGLGEQERLGGSLARRLPLLGDLTQPDHKLVDPWWTRKGEEPGLSTLPYRQE
G
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgtaccccaaggagctgccctcaaggctcctcgtggatccaatggggctacaagagacc
agccagcacctcttcatcctcctcctgctgggccggctgggtgcctcctgcacagctgac
aggtgctgttttgcagagctgccctatctggatgaagactcaggttcctcctctggcccc
aggaacctcacttgctaccgggtcttcaacacagatcactacgagtgctcatggcagtat
gagggtcctgtggatggggtcacccacttcctgaggtgctgcctcagcactgagcactgc
tgctacttctccgcgggctcctccaccctggtgcagttctctgagcaggatggtgtccac
gtgctctccaatgtcacgctttgggtggagtctcagagggcaaattggaccatgaagtca
cagaagataacactgcagctgttcagctgggttaagctggaccctcccctgggagacatc
aatgtgtcccggtctgatggtcaaattcggatgatgtgggagacgtcaaaggacggtgcg
gaggtacagttccgacgaggcactcccaacagcggctggatattgggtgactgtggaccc
caggatgtttctggcttagagtcctgcctctgcccttcggagttgaatgtggcccagaag
ttccaggtccggcgccggcgccggctcccatcagggattcccggagggccctggagtagc
tggagcggcaatgtgtgtgtcccacctgaaacccttccccagcccaagattaagttcctg
atggagccactgggccaggatgggaggcggaggctgaccgtacaggggcagtcactgcag
cctgatcttccagagaactgccaggatgtcatgccgggtgggcaggtgacacacttggta
cacatgagaatgctctcctgcccctgccagccctggacctcaaggactgtgaagctgggc
aagacgttgcacatctctggggccgcctacgacatggttgtagttgcccagacacgtttt
gcacgaagtcccatccagacctggcaccttccagcccaggagttttcagctctgggacct
ctgaacatcagccaggaaggcaacaggacatccctgcactgggcagcccaggctccaggc
actgcctactgcattgagtggcagctggacagccaggacagaagccacgacaactgcact
cttactgcaccagaagacaaggtcccggctgggatggcagctcacacctggagcccagaa
cctggggcaatgaaggaggactgttaccgtgtcaccatcttcgcctccttgcgtcccgat
acgctctcatcctggtcgaccgtcctgtcgggttactactttgggggcaatgcttcggtg
gccgggaggccacagcgtgtctccgtgaagaactacagtggagactcagtatccttggag
tggacgccatctcagctgagcacctgcccaggagtcctgaaacaatacgttgtgcgctgg
gaagcagaggacagtgaaccggtgtcagagaggctcctgccacccacagagacccaagtc
acccttcagggactgcggacaggggtggtgtacacggttcaggtgcgggcagacacggag
tggctcccgggtgcctggagccagccccagcgcttcagcttcgagctgcagatttcccgc
ctgtccatcgtcttcgcctctctggggagctttgccagtgtcctcctcgtgggtgtcctt
ggataccgaggcctgaatagggccgcctggcacctgtgcccacccctgcccacaccctgt
gccagcacagctttggagttccctggcatccagggcaagcagacttggcagtggagtagc
cctggggacttcccggaagtgctgtggccgcaagagatgctagtggtggagatgccctgg
gacagaaatgaccagacagagccggcccaggcctgccctgagcccaccgtggatctggag
ccatccttgcagcaggacgcagtcctgggtctgggcgagcaggaacgtttgggtggcagc
ctggcccggagactcccactcctgggagacctgacccaaccggaccacaaacttgtcgat
ccctggtggacccggaagggtgaagaaccgggactgtccaccttgccttaccggcaggag
ggctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727306
Entry
103727306         CDS       T03372                                 

Gene name
Il2ra
Definition
(RefSeq) interleukin 2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04144  Endocytosis
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi05162  Measles
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103727306 (Il2ra)
   04151 PI3K-Akt signaling pathway
    103727306 (Il2ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103727306 (Il2ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103727306 (Il2ra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103727306 (Il2ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103727306 (Il2ra)
   04658 Th1 and Th2 cell differentiation
    103727306 (Il2ra)
   04659 Th17 cell differentiation
    103727306 (Il2ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103727306 (Il2ra)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103727306 (Il2ra)
   05162 Measles
    103727306 (Il2ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103727306 (Il2ra)
   04090 CD molecules [BR:ngi04090]
    103727306 (Il2ra)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL2 receptor family
   103727306 (Il2ra)
CD molecules [BR:ngi04090]
 Proteins
  103727306 (Il2ra)
SSDB
Motif
Pfam: Sushi DUF202
Other DBs
NCBI-GeneID: 103727306
NCBI-ProteinID: XP_008823365
LinkDB
Position
Un
AA seq 267 aa
MWLTDSSEESAICYLTGNSTKMCLYNPPEVPYATFKALAYKNGTMLNCDCKKGFRRVNGL
LYVLCSGNSSWSNTCQCASNSNRNTRKRVTPQPEEHKERQTTETQSSAWSVDQGNIPGHC
REPPPWDHESTKRIYHLKVGQTVYYQCIQGYKALQKHPATSVCKTICGKTGWTQPRLTCV
DEREHHQFQDKEEYLESTDTLPESETSCPITITDTQQPPEATTTMETFFLTMEHQITVAG
CVFLLISILLLSGLTWRWRWKKSRRTI
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtggctgactgacagttcagaggaatcagctatctgctatttgactggcaactcgaca
aagatgtgtctgtataacccaccagaagtcccctacgccacattcaaagccctcgcctac
aagaatggcaccatgctgaactgtgactgcaagaaaggtttccgcagagtaaacggattg
ctctatgtactgtgctcagggaactcttcctggagcaacacgtgtcagtgtgcaagcaac
tccaacagaaacacaagaaagcgagttacacctcaacccgaagaacataaagagagacaa
accacagaaacgcaaagttcagcatggtcggtggaccaaggaaacattccaggtcactgc
agggagccccctccatgggaccatgaaagtacaaagagaatctatcatctcaaagtggga
cagacagtttactaccagtgcattcaggggtacaaggctctccagaaacatcctgccaca
agtgtctgtaaaaccatctgtggaaagacagggtggactcagcctcggctcacatgtgta
gatgaaagagagcaccatcaatttcaagacaaagaagaatatctagagagtacagatacc
cttcctgagagtgagacttcctgccccatcaccatcacagacacccaacaacctccagaa
gcaactacaacaatggagacgttcttccttacaatggagcatcagataacagtggctggc
tgcgtcttcctgctgatcagcatcctccttctgagtgggctcacctggcggtggagatgg
aagaaaagtcgaagaaccatatag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727307
Entry
103727307         CDS       T03372                                 

Gene name
Il15ra
Definition
(RefSeq) interleukin 15 receptor subunit alpha
  KO
K05074  interleukin 15 receptor alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103727307 (Il15ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103727307 (Il15ra)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    103727307 (Il15ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103727307 (Il15ra)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103727307 (Il15ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103727307 (Il15ra)
   04090 CD molecules [BR:ngi04090]
    103727307 (Il15ra)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL2 receptor family
   103727307 (Il15ra)
CD molecules [BR:ngi04090]
 Proteins
  103727307 (Il15ra)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 103727307
NCBI-ProteinID: XP_017651594
LinkDB
Position
Un
AA seq 256 aa
MPPSSSRSSAPSSLPLFPVATLGIYLGWKAHWESDLATIHCPEASALGRHLRCHPQTRPR
TARALATQRETLKAAARGTTCPTPTSVEHADIRVKNYNVNSRERYVCNSGFKRKAGTSTL
TECVLNKTTNVAHWTTPNLKCIRDPTLARQRPVPPSTVVTPRATPEPKSPSPPGKEIPTE
PEALSPKPNTTVASETALVPGSQLAPSQPPSAGTTGTGSHESSQAPSPTTAKTLEPSSST
SLRTPGVSPHSSKTIA
NT seq 769 nt   +upstreamnt  +downstreamnt
atgccgccaagctcctcccgctcctccgccccttcctccctccctcttttccctgttgca
actcttggcatttacttgggttggaaagcgcactgggaaagtgacctggccacgattcat
tgcccagaggcgtccgcgctggggcgacatctccgctgtcacccacagaccagaccgcgg
acggcccgagctctggccacccagagggaaactttgaaagctgcagcccgaggcaccacg
tgcccaactcccacatctgttgaacatgcagacattcgggtcaagaattacaatgtgaac
tccagggagaggtacgtttgtaactctggtttcaagcggaaagccggcacttccaccttg
acagagtgtgtgttaaacaagacaacaaatgttgctcactggacaacgcccaatctcaaa
tgcatcagagaccccaccctggctcgccaaaggccagtgccaccctccacagtagtgact
ccaagggcgaccccagagccaaagagcccctcccctcctggaaaagaaattcctacagaa
ccagaagctttatctcccaagccaaataccacagtggcctcagagacagctcttgtgcca
ggttcccagctggcaccatcccaaccaccttctgcaggaaccacagggacaggcagtcat
gagtcttctcaagccccatctcccacaacagcaaagaccctggagccttcatcctccacc
tccctcaggacaccaggggtttctccacacagctccaaaacgatagctg

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732502
Entry
103732502         CDS       T03372                                 

Gene name
Lepr
Definition
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04152  AMPK signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103732502 (Lepr)
   04152 AMPK signaling pathway
    103732502 (Lepr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103732502 (Lepr)
   04060 Cytokine-cytokine receptor interaction
    103732502 (Lepr)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103732502 (Lepr)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103732502 (Lepr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103732502 (Lepr)
   04090 CD molecules [BR:ngi04090]
    103732502 (Lepr)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  Prolactin receptor family
   103732502 (Lepr)
CD molecules [BR:ngi04090]
 Proteins
  103732502 (Lepr)
SSDB
Motif
Pfam: ObR_Ig fn3
Other DBs
NCBI-GeneID: 103732502
NCBI-ProteinID: XP_008829311
LinkDB
Position
Un
AA seq 1025 aa
MIFQKFYVVLLHWEFLYVITALNLASPLSPWRFKLFCIPPNITDGAFLSPAGISKNSSDS
SGEYDAVVKATFNSSGTYTSELSKTVFHCCFGNEQGENCSVPADNTGGKTFASTVKSLVF
QQRGINWNIQCWMKGDLTLFICYMEPLFRNPFKNYHFKIHLLYDLPDVIDDLPLAPQKDS
FQIVQCNCSVQECECHVPVPTAKLNHTLLMYLQITSAGMIFQSPLMSVQPMLVVKPDPPL
GLHMEITDDGNLKISWYSPTLLPFPLQYQVKYSENSTTIMREADEIVSATSLLVDSVLPG
TSYEVRARGKRLDGPGVWSDWSSPRVFTTQDIVNTSVWCGLSSLYCSDSPSIHPVSEPKD
CDLQQDGFYECVFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSSVKAEI
TVNIGLLKVSWEKPVFPENNLHFQIRYGFNGKEMQWKMHEVYDAKSKSANLPVPDLCAVY
AAQVRCKRLDGLGYWSNWSSPAYTVVMDVKAPLRGPEFWRVINGDITQKERNVTLLWKPL
MKNDSLCSVRRYVVKHLTSHNGTWSEDVGNNTNLTFLWTEQAHTVTVLAINSIGASLANL
NLTFSWPVSKVGAVQSLSAYLLSSSCVILSWTLLPSDYNIMYLIIEWKNLNEDDGIKWLR
IPSNAKKYYIHDNFIPIEKYQFSLYPIFMEGVGKPKIINGFTQDDIDKPWNDAGLYVIVP
IIISSCVLLLGTLLISHQRCGGFNPNPSSWEPETFEHLFTKHAESVIFGPLLLEPEPISE
DISVDTSWKNKDDMVPSTMASLLLTTPDLEKGSVCISNQCNSGHFSEAESTQVTCEDECR
RQPSVKYATLASNSKSSETDEEQGLIRSSVSKHFPSKHFPRKDSFSDSPWEIETQAFFIL
PDQQPTMISPHLSLSGLDELLELEGNFPAEDHSEKSVYYLGVTSIKKRENGGFLTDESGV
LCPFPAHCLFSDIRILQDSCSHFVENNFSLGTPGKKTFIPYMPQFQTCSSHTHKLMETKM
CDLTV
NT seq 3078 nt   +upstreamnt  +downstreamnt
atgatttttcagaaattctatgtggtcttgttacattgggaatttctctatgtgataact
gcacttaacctggcatctccactttctccctggaggtttaagttgttttgcataccacca
aatataactgacggtgcctttctctcgcctgctggaatctcaaagaactcctcagattcg
agtggggagtatgatgccgtcgtcaaagctacgtttaattcaagtggcacctacacttct
gagttatctaaaacagttttccactgttgctttgggaatgagcaaggcgaaaactgctct
gtacccgcagacaacactggagggaaaacatttgcttcaacagtaaagtctttagttttt
cagcaaagaggcataaactggaacatacagtgctggatgaaaggggacttgacactgttc
atctgctatatggaaccattatttaggaatcccttcaagaattaccactttaagatccat
cttctatatgatctgcctgatgtgatagatgatttgcctctggctccccagaaagacagt
tttcagattgttcagtgcaactgcagtgttcaggaatgtgaatgccatgtgccagtgcca
acagccaaactcaaccacactctgcttatgtatctacaaatcacatctgctggcatgata
tttcagtcacctctgatgtcagtgcagcccatgcttgttgtgaaacctgatccaccatta
ggtttacatatggaaatcacagatgatggtaatttaaaaatttcttggtacagcccaaca
ctgttaccctttccacttcaatatcaagtgaaatattcagagaattctacaacaattatg
agagaagctgatgaaatcgtctcagctacatccctgctagtggacagtgtgcttcctggg
acttcgtatgaggttcgggccaggggcaagagactggacggcccaggagtctggagtgac
tggagttcccctcgtgtctttaccacacaagatatagtcaacacaagtgtctggtgtgga
ttgagcagcctatactgttctgatagtccatctattcatcctgtatctgagcccaaagac
tgtgacttgcagcaggatggcttttatgaatgcgttttccagccaatcttcctgttatct
ggctacacaatgtggattaggatcaaccattcattgggttcacttgactctccaccaacg
tgtgtccttcctgactctgtagtaaaacctctacctccatctagcgtgaaagcagagatt
actgtaaacattggattactaaaagtatcttgggaaaagccagtctttccagagaataac
cttcacttccagatccgatatggcttcaatggaaaagagatgcaatggaagatgcatgaa
gtatatgatgcaaaatcaaagtctgccaatcttccggtgccagacctatgtgcagtctat
gcagctcaggtgcgctgtaagcggttggatggactggggtattggagtaattggagcagt
ccagcctacacggttgtcatggatgtaaaagctcctttaagaggacctgaattttggaga
gtaattaatggtgatattactcaaaaagagagaaacgtcaccttactttggaagcccctg
atgaaaaatgactcgttgtgcagtgtgaggaggtatgtggtaaaacatctcacttcccac
aacggaacgtggtcagaagatgtagggaataacaccaatctcactttcctatggacagag
caagcacatactgttacagttctggccatcaattccattggtgcttccttagcaaacctg
aatcttacattctcatggccggtgagcaaagtaggtgccgtgcagtcactcagtgcttac
ctcctaagcagcagctgtgtgattctttcctggacgctgttacccagtgattacaatata
atgtacttgattattgaatggaagaatcttaatgaagacgatgggattaaatggcttaga
attccttcaaatgccaagaagtattatattcatgataattttattcccattgagaaatat
cagttcagtctttacccaatatttatggaaggagtaggaaaaccaaagataattaatggt
ttcacccaagatgatatcgacaagccctggaatgatgcgggtctgtatgtgattgtgccc
ataatcatttcctcttgtgtcttactgctcggaacactgttaatatcacatcaaaggtgt
ggtggttttaatcccaatccaagctcttgggagcctgaaacatttgagcatctttttacc
aagcatgcagagtcagtgatatttggtcctcttcttttggagcctgaacccatttcagaa
gatatcagtgtcgatacatcctggaaaaataaagatgacatggtaccatcaactatggcc
tcgcttcttctgaccactccagatctagaaaagggttctgtttgtattagtaaccagtgt
aacagtggtcacttctctgaggctgagagcacccaggtaacctgtgaggatgagtgtcgc
agacagccctcagttaaatacgcaacactagccagcaactccaaatcaagtgaaaccgat
gaagagcaagggcttattcgtagttctgtcagtaaacacttccctagcaaacactttcca
cggaaagattccttttccgacagcccttgggagatagagacccaggcgttttttatatta
ccagatcagcaacccaccatgatttcaccacacctctccctctcaggattggatgagctt
ttggaactggagggaaatttccctgcagaagaccatagtgaaaagtctgtctattactta
ggggttacctcaatcaaaaaaagagagaatggaggatttttaactgatgagtcaggagtg
ttatgtccattcccagcccactgtttattcagtgatatcagaatcctccaggacagttgc
tcacactttgtagaaaataatttcagtttaggaacccctggtaagaagaccttcatacct
tatatgccccaatttcaaacctgttccagtcacactcataagctaatggagaccaagatg
tgtgacctcactgtgtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103733325
Entry
103733325         CDS       T03372                                 

Gene name
Csf3r
Definition
(RefSeq) colony stimulating factor 3 receptor
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103733325 (Csf3r)
   04151 PI3K-Akt signaling pathway
    103733325 (Csf3r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103733325 (Csf3r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103733325 (Csf3r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103733325 (Csf3r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103733325 (Csf3r)
   04090 CD molecules [BR:ngi04090]
    103733325 (Csf3r)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  Prolactin receptor family
   103733325 (Csf3r)
CD molecules [BR:ngi04090]
 Proteins
  103733325 (Csf3r)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind fn3_2
Other DBs
NCBI-GeneID: 103733325
NCBI-ProteinID: XP_008830372
LinkDB
Position
Un
AA seq 841 aa
MVGLRGCSLTGVALIFLLLPESLESCGHIRISAPVVHLGDPITASCSISPNCSHLNQEPQ
ILWQLEDGPKQLGDRQQRLPQGIQESTITLPHLNHTQAFLFCFVQLGNSFQVLDQAELQA
GYPPAKPSNLSCLMNLTTSSLICQWEPGPETYLPTNFTLKSFRSRADCQRWEDPVLDCVP
EDGQSYCSIPRKHLLLYQNMVIWVQAENVLGTSESLRLCLDPMDVVKLEPPTLWALDFSP
DVVPPQPGCLWLRWEPWKPSQFMDQECELRYQAQFSGTSWTQVPHLPSRGHRFELCGLHQ
ALVYTLQMRCIRSLLPGHWSSWSPSLQLKPSIQAPIVRLDTWWRQRQLDPNTVGVQLFWK
PTPLQEDSGKIQGYLLSWSPSGQQGLGLPLCNTTELSCTFLLPSGAQRLTLIAYNTRGTS
WPTPVVFLENKGPAVARLHAMAQDPHSLWVDWEAPSPQPQGYLIEWGLECPSHNCSNKSW
RMEPNGNSTGTLLQENISPFQLYKITVAPLYPGTIGPYQHVYAYSGEKAFPHAPELHLKQ
IGRTWAQLEWVPKPPELGRTPLTHYTIFWTNAQNQSFSTIMNTSSHGFVLHNLEPASLYH
VILMATSRAGATNSTGLTLMTLTLGASELYILLGLFGFLVLFISLCATVWFCCKPSRKNS
LWPSVPDPAHSSLGSWVPTVMAEETFQVPSLWDPSIPSITKITVLEEEKKSTSWDSSDSS
EACSFPTLVQAYVLQGAPKASSIQFQPPSGTSDQVLYGQVLGSPTSPGPGQYLRCDSTQP
LLGGLTPSPKSYENLWFQPSPLETLVSLPPSQEDDCVFGSPFDFALFQGLRVHGIEEQEG
F
NT seq 2526 nt   +upstreamnt  +downstreamnt
atggtgggcctgagaggctgcagcctgacaggagttgctctgatcttcctgctactccct
gaaagcctggagagctgtgggcacatcaggatctcagcccctgttgttcatctgggggac
cccatcacagcctcctgctccattagcccaaactgcagccacttgaaccaagagccacag
atcctatggcaactggaagatgggccaaagcagcttggagacaggcagcaacgcctgcct
caggggatccaagaatccaccatcaccctgccccacctcaaccacacccaggcctttctc
ttctgctttgtacaactgggcaacagcttccaagttctggaccaagctgagcttcaggca
ggctaccctcctgccaaaccctccaacctgtcctgcctcatgaaccttaccaccagcagc
ctcatctgtcagtgggagccaggccctgagacatacttacccaccaacttcaccctgaag
agcttcaggagtcgcgccgactgtcagcgctgggaggaccctgtcttggactgcgtgcct
gaggatgggcagagctactgctccatcccccgaaaacacctgcttctgtaccagaatatg
gtcatctgggtgcaggcagaaaacgtgctggggaccagcgagtccttgaggctgtgcctt
gaccccatggatgttgtgaaactggagccccccacactgtgggccctagacttcagccct
gatgtggtcccaccccagccgggctgcctgtggctgcgatgggagccatggaagcccagt
caattcatggaccaggagtgtgagcttcgctaccaggcacaatttagtggaaccagctgg
acacaggtgccccacctgccctccagagggcatagatttgagctctgtggactccatcag
gccctggtctacaccctgcagatgcggtgcatccgttcactcctgcctggacactggagc
agctggagccccagcctgcagctgaagcccagcattcaggcccccatcgtcagactggac
acgtggtggcggcagagacaactggatcccaacacagtaggcgtgcagctgttctggaag
ccgacacccctgcaagaagacagtgggaagatccaggggtacctgctctcctggagtccc
tcgggacagcaagggctgggcctgcccctgtgcaacaccacagagctcagctgtaccttc
ctcctgccttcaggagcccagaggctgaccctcatagcctacaacacaaggggtacctct
tggcctactccagtggtcttcttggagaacaaaggcccagctgtggccagactccacgcc
atggctcaagatcctcacagcctctgggtggactgggaagcccccagccctcagccgcag
ggctatctgattgaatggggcctggagtgccccagccacaactgcagcaataagtcctgg
aggatggagcctaatgggaacagcactgggactctgttacaggagaacataagccctttt
cagctgtacaagatcacggtggctcccctgtacccaggcactataggaccttaccaacat
gtctacgcctactctggagagaaagcctttcctcatgccccggagctgcatctaaagcag
attggcagaacctgggcacagctggagtgggtgcccaagccccctgagctggggaggaca
ccccttacccactataccatcttctggaccaacgctcaaaaccagtccttctccaccatc
atgaatacctcctcccacggctttgtcctacacaacctggagcctgccagtttgtatcat
gtcatccttatggccaccagccgggcaggagccaccaacagtacgggcctcaccctgatg
accttgaccctaggggcatctgagctatacatcctcctgggcctatttggctttctggtt
ttgttcatcagcctctgtgcaactgtctggttctgctgcaagcctagcaggaagaattcc
ttatggccaagtgtgcctgacccagctcacagcagcctgggctcctgggttcccaccgtc
atggcagaggaaaccttccaggtgcccagcctctgggaccccagcataccatccatcacc
aagatcactgtgctggaggaagagaagaagtcaacatcctgggattctagtgacagctca
gaggcctgcagcttccccaccctagtccaggcctacgtactccaaggggccccaaaagca
tcttccatccagttccagcccccatctggcaccagtgaccaagtcctttatgggcaggta
ctgggcagccccaccagcccaggacctggtcaataccttcgctgtgactccactcagccc
ctcctgggtggcctcacacccagtcctaagtcatatgaaaacctttggttccagcctagc
cccctggagacccttgtgtccctacccccaagccaggaggatgactgtgtctttggatca
ccctttgactttgccctctttcaggggctccgggtccatggaatagaagaacaggagggt
ttctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734393
Entry
103734393         CDS       T03372                                 

Gene name
Pdgfra
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04144  Endocytosis
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04630  JAK-STAT signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05163  Human cytomegalovirus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103734393 (Pdgfra)
   04014 Ras signaling pathway
    103734393 (Pdgfra)
   04015 Rap1 signaling pathway
    103734393 (Pdgfra)
   04630 JAK-STAT signaling pathway
    103734393 (Pdgfra)
   04020 Calcium signaling pathway
    103734393 (Pdgfra)
   04072 Phospholipase D signaling pathway
    103734393 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    103734393 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103734393 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103734393 (Pdgfra)
   04540 Gap junction
    103734393 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103734393 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103734393 (Pdgfra)
   05206 MicroRNAs in cancer
    103734393 (Pdgfra)
   05230 Central carbon metabolism in cancer
    103734393 (Pdgfra)
   05231 Choline metabolism in cancer
    103734393 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    103734393 (Pdgfra)
   05218 Melanoma
    103734393 (Pdgfra)
   05215 Prostate cancer
    103734393 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103734393 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103734393 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103734393 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ngi04090]
    103734393 (Pdgfra)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103734393 (Pdgfra)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103734393 (Pdgfra)
CD molecules [BR:ngi04090]
 Proteins
  103734393 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Ig_6 DUF3912 Kinase-like DUF6232
Other DBs
NCBI-GeneID: 103734393
NCBI-ProteinID: XP_008831544
LinkDB
Position
Un
AA seq 1088 aa
MGTFHWAFLVFGCLLTGPSLILCQLLLPSILPNENEKVVQLNSSFSLRCFGESEVSWQHP
MSEEEDPDVEIRSEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTEESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPETHVTLYNEGRLVFASYDSKQGFNG
TFSVGPYICEATVQGKTFQTNAFNVYALKATSELNLEMEAHQTVYKSGETIMVTCAVFNN
EVVDLQWTYPGEVKNKGITMLEEIKVPSIKLVYTLTVPKATVKDSGDYECAARQATKEVK
EMKTVTISVHEKGFVEIKPTFGQLEAVNLHQVREFVVEVQAYPTPRISWLKDNLTLIENL
TEITTDVKKIQETRYQSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELSTLVPASILEL
VDDHHGSGGGQTVRCTAAGTPLPDIEWMICKDIKKCNNDTSWTTLANNISNIPTELHRRG
RSTVEGRVTFAKVEETIAVRCVAKNHLGNGNRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLAR
DIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMV
DSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKKS
YEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEDDKLKDWEGGVDEQRLSADSGYIIP
LPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSS
DLVEDSFL
NT seq 3267 nt   +upstreamnt  +downstreamnt
atgggaactttccactgggccttcctggtcttcggctgtctcctcacagggccgagcctc
atcctctgccagctcttattaccctctatcctcccaaatgagaacgagaaggttgtgcag
ctgaattcatccttttctttgagatgctttggggagagtgaagtgagctggcagcacccc
atgtctgaagaagaggaccccgacgtggaaatcagaagtgaggagaacaacagcggcctc
tttgtgacagtgctggaagtggtcaacgcctcggcagcccacaccggatggtacacttgc
tattacaaccacactcagacagaagaaagtgagatagagggcaggcacatttacatctat
gtgccagacccagacatggcctttgtgcctctaggaatgacagattctttagtcattgtg
gaagaagacgattctgccatcataccttgtcgcaccacagatccagagactcatgtaact
ctgtacaatgagggtaggctggtgtttgcctcttacgacagcaagcagggcttcaatggg
accttcagtgtggggccctacatctgtgaggccaccgtccaagggaagacattccagacc
aatgcatttaatgtttatgctttgaaagcaacatcggagctgaatctagagatggaagct
catcaaactgtatataaatcaggagaaacgatcatggtgacctgtgctgtctttaacaat
gaggtggttgatcttcagtggacttaccctggagaagtgaaaaacaaaggcatcaccatg
ctggaagaaattaaggtcccatccatcaaattggtgtacactttgacagtccccaaggcc
acggtgaaagacagtggagattatgagtgtgctgcccgccaggctactaaggaggtcaaa
gaaatgaagacagtcaccatttctgtccatgagaaaggttttgttgagatcaagcccacc
tttggccagctggaagccgtcaacctgcatcaagtcagggagttcgtggtggaggtacaa
gcctaccctactcccaggatatcatggctgaaggacaacttgactctgattgagaatctc
actgagatcaccactgatgtgaaaaagattcaggaaacaaggtatcaaagcaaattaaag
ctgattcgggctaaggaggaagacagtggccattataccatcgtagttcaaaatgaagat
gatgtgaagagctacacttttgagctgtcaactctagttcccgcatccattctggagctg
gttgacgaccatcacggctctggtgggggacagactgtgaggtgcacagctgcaggcaca
cctcttccggacatcgagtggatgatctgcaaggatattaagaaatgtaataatgacact
tcatggacaactttggccaacaatatctcaaatatccccactgagctccaccgccgaggc
aggagtactgtggagggccgagtgacattcgccaaagtcgaggagaccattgcagttcga
tgcgtggcaaagaatcaccttgggaatgggaaccgagaactgaagctggtggctcccacc
ctgcgttctgagcttacagtagcagctgcagtcttggtgctgttggtgattgtgataatc
tcactcattgtcctggttgtcatttggaagcagaaaccacggtatgaaattcgctggagg
gttattgagtcaatcagccctgatggacatgaatatatttatgtggacccgatgcagctt
ccctatgactccagatgggagttcccaagagatggactagtgcttggtcgaatcctggga
tctggtgcatttgggaaagtagttgaaggaacagcctatggattaagccggtcccagcct
gttatgaaggtagcagtgaagatgctcaaacccacagccagatccagtgaaaagcaagct
ctcatgtctgagctgaagataatgactcacttgggaccacatttaaacattgtgaacttg
ctgggagcctgcaccaagtcaggccctatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaacagagatagcttcctgagccgacacccagagaag
ccaaagaaagagctggacatctttggattgaaccctgctgatgaaagtacaaggagttat
gtgattttatcttttgaaaacaatggtgactacatggacatgaagcaggctgataccaca
cagtatgtccccatgcttgaaaggaaagaggtttctaaatattcagacatccaaagatcg
ctgtatgatcgtccagcctcctataagaagaaatctatgctagactcagaagtcaaaaat
ctcctttcagatgactcggaaggccttactttgctggatttgttgagcttcacctatcaa
gttgcccgaggaatggagtttttggcttcaaaaaattgtgtccatcgggacttggctgcc
cgcaatgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcctggccaga
gatattatgcatgattcaaactacgtgtcaaaaggcagcaccttcctgcctgtgaagtgg
atggcccctgagagcatctttgacaacctatacaccaccctgagtgatgtctggtcttat
ggcattctcctttgggagatcttttctcttggtggcacaccctaccctggcatgatggta
gattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccatgcc
accagtgaagtctatgagattatggtacagtgctggaacagtgagccagagaagagaccc
tccttctaccatctgagtgagatagtggagaatctgttgcctggacaatataaaaagagt
tatgaaaagattcacctggacttcctgaaaagtgatcaccctgctgtggcacgcatgcgt
gtggactccgacaatgcgtacattggtgtcacctacaaaaatgaagacgacaagctgaag
gactgggagggtggcgtggatgagcagagactgagtgctgacagtggctacatcatccct
ctgccagatattgaccctgttccagaggaggaagacctgggcaagagaaacagacacagc
tcccagacctctgaagagagtgccattgagacaggttccagcagttccaccttcatcaag
agagaggacgagaccattgaggacattgacatgatggatgacattggcatagactcctca
gacctggtggaggacagcttcctgtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734578
Entry
103734578         CDS       T03372                                 

Gene name
Epor
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103734578 (Epor)
   04151 PI3K-Akt signaling pathway
    103734578 (Epor)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103734578 (Epor)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103734578 (Epor)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103734578 (Epor)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103734578 (Epor)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  Prolactin receptor family
   103734578 (Epor)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 LIFR_N
Other DBs
NCBI-GeneID: 103734578
NCBI-ProteinID: NP_001288606
UniProt: Q4LB11
LinkDB
Position
Un
AA seq 501 aa
MGYFLGVPLWPPVGPLCLLLAGAAWAPSPSLQDPKFEGKAAMLASRGSEELMCFTERLED
LVCFWEEAVSSNYSFTYQLEGESRKSCGLHQAPTTRGTVRFWCSLPTADTSSFVPLELRV
IATSGTLRYHRIIHINEVVLLDAPTGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDV
SAGNGAGGVQRVEILEGRTECVLSNLRGGTRYTFSVRARMAEPSFSGFWSAWSEPASLLT
TTDLDPLILTLAVILVLIAMLLIVLALLSNRRSLKQKIWPGIPSPESEFEGLFTTHKGNF
QLWLLQHDGCLWWSPWTPFSEDPPARLEVLSECCWGITQASRPDMDDEGPLLEPVDSEQA
QDTYLVLDEWLLPRSPGSKDLSGPGDTVGPVAVDESSRASSCSSDLALKSRPEDTSPSSF
EYTILDSSSQLLRPRALPPQLPPTPPHLKYLYLVVSDSGISTDYSSGGSQGVHGDSSNGP
FSHPYENSLSQPQSLCPHGLL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggggtacttccttggggtgcccctgtggcctccagtcggacccctctgtctcctactt
gccggagcagcctgggcgccttcacctagcctccaggaccccaagtttgagggcaaagcg
gccatgctggcatcccgtggctcggaagaacttatgtgcttcacagagcgattggaggac
ttggtctgtttctgggaggaagcagtgagctccaactacagcttcacttaccagctcgag
ggtgaatcacgaaagtcgtgtggcctgcaccaggcgcctacaacccgcggtacagtgcgt
ttctggtgctcactgcctaccgcagacacatcaagcttcgtgcccctggaactgcgagtc
atagccacctccgggactctgcgctatcaccgtatcatccacatcaatgaagtagtgctc
ctggacgcccccacagggctgctggcacgacgggctgaggaaggcagccacgtggtgctg
cgctggctgccacctcctggggcaccgatgaccacccatatccgatatgaggtggatgtg
tccgcaggcaacggtgcagggggagtgcagagggtggagatcctggaaggccgcacagag
tgtgttctgagcaacctgcggggcggtacgcgctacaccttctcagtgcgcgcacgcatg
gcagagcccagtttcagcggtttctggagcgcttggtctgagcccgcgtcgctgctgacc
actactgacctggacccgctaatcctgacgctggctgtcatcctggtcctcatcgcgatg
ctgctgatagtgctggctctgctctccaaccgccggagcctgaagcagaagatttggcct
ggcatcccaagcccagagagcgaatttgagggtctcttcaccacccacaagggtaacttt
cagctgtggctgttgcagcatgatggttgtttgtggtggagcccatggacccctttctct
gaggacccaccagcccgactggaagtcctctcggagtgctgttgggggatcacccaggcc
tccaggcctgacatggatgatgaggggcccttgctggagccagtggacagtgagcaagcc
caggacacctacctggtgttggatgagtggttactgcctcggagcccaggcagcaaggac
ctctcaggacctggggacactgtgggtccagtggctgtggatgaaagctccagagcatct
tcctgctcctctgacttggccttgaagtctaggccagaggatacctcaccttccagcttt
gagtataccatcctagactccagctctcagctcttgcgccctcgggcactgccccctcag
ctacctcccacccctcctcacctaaagtacctgtacctcgtggtatctgattcaggcatc
tcaacagattacagttcaggaggctcccagggagtccatggggactcatccaatggcccc
ttctctcacccttatgagaacagcctgtcccagccccagagcctctgcccacatggtctg
ctgtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735901
Entry
103735901         CDS       T03372                                 

Gene name
Prlr
Definition
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103735901 (Prlr)
   04151 PI3K-Akt signaling pathway
    103735901 (Prlr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103735901 (Prlr)
   04060 Cytokine-cytokine receptor interaction
    103735901 (Prlr)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103735901 (Prlr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103735901 (Prlr)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  Prolactin receptor family
   103735901 (Prlr)
SSDB
Motif
Pfam: EpoR_lig-bind IL6Ra-bind fn3
Other DBs
NCBI-GeneID: 103735901
NCBI-ProteinID: XP_008833530
LinkDB
Position
Un
AA seq 617 aa
MKDNVASTIAFILLLCLNISFLNGQSPPGKPEILKCRSPDKETFTCWWKPGTDGGLPTNY
SLTYVREGDENTYECPDYKTSGPNSCFFSKKYTSIWKIYIITVNATNQMGTTASEPLYVD
VTYIVEPEPPRNLSLEVKWPKDRKPYLLIRWSPPNITDLRSGWFTMEYEIRLKSEETDEW
EIHFAGQQTQFKIFSLYPGQKYFVQTRCKPDHGYWSRWGQESAIDIPNDFTMKDTTVWIF
VAVLSAVICLIMVWAVALKGYSMMTCIFPPVPGPKIKGFDTHLLEKGKSEELLSALGCQD
FPPTSDCEDLLVEFLEVDDNEDEQLMPSHSKEYPGQGVKPTHLDPDSDSGHGSYDSHSLL
SEKCEEPQAYPPTFHIPEIIEKPENPEENITPIQDPQSNIPYFHADVSKSSTWPLLPGQH
MPRSPYHSIADVCKLAGAPVDAVASFLDKAGKNALKSSKAFETGKEEKVAKQEMESLHSK
TKEETSWPLLQEKASFIYAKPLDYVEIHKVNKDGVLSLLPKQKENCDQVEKPRASETSKE
YAKVSGVTDNNILVLVPESQVQNMALFEESAKKAPSPLEQNQSEKDLASFAGTSSNCRLQ
LGRLDYLDPTCFMHSFH
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgaaggacaacgtggcatccaccattgccttcatcctgctactttgcctcaacatcagt
tttctgaatggacaatcaccacctggaaaacctgagatcctcaaatgtcgttctcctgat
aaggaaactttcacctgctggtggaaacctgggacagatggaggacttcctaccaattat
tcactgacttatgttagagaaggagatgaaaacacctatgaatgtccagactacaaaacc
agtggccccaactcctgtttctttagcaagaagtacacatccatatggaaaatatacatc
atcacagtaaatgccactaaccaaatgggaaccactgcctcagagccactttacgtggat
gtgacttacatagttgagccagaacctcctcggaacttgtctttagaagtgaagtggcca
aaagacagaaaaccatatctgttgataagatggtccccacccaacataacggatctaaga
agtggttggttcacaatggagtatgaaattcgattaaagtctgaggagacagatgagtgg
gagattcattttgcagggcagcaaacacagtttaagattttcagcttatatccaggacaa
aaatactttgttcagactcgctgcaagccagaccatggatactggagcagatggggccaa
gagagtgccattgatatacctaatgacttcaccatgaaagatacaaccgtgtggatcttt
gtggctgttctttctgctgtcatctgcttgattatggtctgggcagtggctttgaagggc
tatagcatgatgacctgcatctttccaccagttcccgggccaaaaataaaaggatttgat
actcatctgctggagaagggcaagtctgaagaactcctgagtgccttaggatgccaagac
ttcccccccacttctgactgtgaggacttgctggtggagtttttagaagtggatgacaat
gaggacgaacagctaatgccatcccattcaaaagagtacccaggtcaaggtgttaaaccc
acacatctagatcccgacagtgattctggccatggaagctatgacagccattctcttttg
tctgaaaagtgtgaggagccccaagcctatccccctactttccacattcctgagatcatt
gagaagccagagaatcccgaagaaaatattactcccatccaagacccccagagcaacatc
ccctattttcatgcagatgtgtccaaatcttcaacatggcctttactgcctggccaacat
atgcccagatctccttaccacagcattgctgatgtgtgcaagctggccggagcccctgta
gatgcagtggcctctttcctggacaaagcaggaaaaaatgctttaaaatcttctaaagct
tttgagactggaaaggaagaaaaggtggctaagcaggagatggaaagcctccattcaaag
actaaagaagagacatcatggccactgctccaggagaaagcctcctttatctatgctaaa
cccctggattacgtggagattcataaggtcaacaaagatggagtactatcattgttacca
aaacagaaagaaaactgtgaccaggtggagaagcctcgggcttctgaaaccagtaaagaa
tatgccaaggtgtctggggttacagataacaacatcctggtcttagtgccagagtcacaa
gttcagaacatggctttgtttgaggaatcagccaagaaggctccatcacctcttgaacag
aaccaatctgagaaagacctggccagcttcgctggaacatcaagcaactgcaggctccaa
ctgggcaggctagattacctggatcctacgtgcttcatgcactcctttcattaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736453
Entry
103736453         CDS       T03372                                 

Gene name
Ifngr2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04066  HIF-1 signaling pathway
ngi04217  Necroptosis
ngi04380  Osteoclast differentiation
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi05140  Leishmaniasis
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05164  Influenza A
ngi05168  Herpes simplex virus 1 infection
ngi05200  Pathways in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103736453 (Ifngr2)
   04066 HIF-1 signaling pathway
    103736453 (Ifngr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103736453 (Ifngr2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103736453 (Ifngr2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103736453 (Ifngr2)
   04658 Th1 and Th2 cell differentiation
    103736453 (Ifngr2)
   04659 Th17 cell differentiation
    103736453 (Ifngr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103736453 (Ifngr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103736453 (Ifngr2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103736453 (Ifngr2)
  09172 Infectious disease: viral
   05164 Influenza A
    103736453 (Ifngr2)
   05168 Herpes simplex virus 1 infection
    103736453 (Ifngr2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103736453 (Ifngr2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103736453 (Ifngr2)
   05140 Leishmaniasis
    103736453 (Ifngr2)
   05142 Chagas disease
    103736453 (Ifngr2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103736453 (Ifngr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103736453 (Ifngr2)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IFN receptor family
   103736453 (Ifngr2)
SSDB
Motif
Pfam: Tissue_fac fn3 Interfer-bind
Other DBs
NCBI-GeneID: 103736453
NCBI-ProteinID: XP_008834184
LinkDB
Position
Un
AA seq 330 aa
MRPPPLWLPQLLLFCSLGAATPPPGSAHLATPRHPKIHLHDDKQVLSWEPVSPGNDMGPV
VYRVEYTYSDNVEWIPTKVNCTKITATKCDFTRDGPLTGFSPLSTVFLRVRAEQGNRTSA
WVMMPSFQYYRNVTVGPPKNLSVTPGEGSLIIHFSPPFEHTSVAIFEYHVRYWEKTGIQQ
VKGPFQSNSIVLDNLKPFRVYCLQVEAQLVVKSQGIHKPGHLSNTSCHETRADASTKLQQ
VFLISLGTFLVLLMLSGACFFLFLKYQSLVKYWFHTPPSIPVQIEEYLKDPAQPILEALD
RGSSPKDDTWDSVSIISFPEKEQENMLQTL
NT seq 993 nt   +upstreamnt  +downstreamnt
atgcggcctccgccgctgtggctgccgcagctgctgctgttctgcagcctcggtgccgcg
acgcccccgccaggctctgcacatctggctactccccgtcacccaaagattcacctacac
gatgataagcaggttctgagttgggagcctgtgtcccccggcaatgacatgggaccagtg
gtctaccgagtggagtatacatacagcgataatgttgagtggatccccacaaaggtgaac
tgcacgaagatcacagcaacaaagtgtgacttcaccagagacggccccctaacaggcttc
tccccacttagcactgttttcctacgtgttcgagctgagcaaggaaatcgtacctctgcc
tgggtgatgatgccttcgtttcaatactaccgtaatgttactgtcggtcctccaaaaaac
ctctcagtgaccccaggagaaggctccctcatcatccacttctccccaccctttgagcac
accagtgttgccatttttgagtatcatgtccgttactgggaaaaaacaggaatccaacag
gtgaaaggccctttccagagcaactccattgtactggataatttgaagccattcagagtg
tactgtttacaagttgaagcacagctagttgtgaaaagccaaggtatccataaacctggg
catttaagcaacacatcttgccacgaaacaagagcagatgcctccaccaagttgcagcaa
gtcttcctgatctccctgggcaccttcttagtgctgttgatgctgtctggggcctgtttc
ttcctgttcctgaaataccaaagcctggtgaaatactggtttcacactccaccaagcatc
ccggtacaaatagaagagtatttaaaggacccagctcaacccatcttggaggctctggac
agaggcagttcaccaaaggatgacacctgggactctgtatccatcatctcctttccagaa
aaggagcaagaaaatatgcttcaaacactgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736454
Entry
103736454         CDS       T03372                                 

Definition
(RefSeq) interferon alpha/beta receptor 1-like
  KO
K05130  interferon receptor 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04217  Necroptosis
ngi04380  Osteoclast differentiation
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103736454
   04151 PI3K-Akt signaling pathway
    103736454
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103736454
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103736454
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103736454
   04621 NOD-like receptor signaling pathway
    103736454
   04650 Natural killer cell mediated cytotoxicity
    103736454
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103736454
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103736454
  09172 Infectious disease: viral
   05161 Hepatitis B
    103736454
   05160 Hepatitis C
    103736454
   05171 Coronavirus disease - COVID-19
    103736454
   05164 Influenza A
    103736454
   05162 Measles
    103736454
   05168 Herpes simplex virus 1 infection
    103736454
   05167 Kaposi sarcoma-associated herpesvirus infection
    103736454
   05169 Epstein-Barr virus infection
    103736454
   05165 Human papillomavirus infection
    103736454
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103736454
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IFN receptor family
   103736454
SSDB
Motif
Pfam: Interfer-bind Tissue_fac
Other DBs
NCBI-GeneID: 103736454
NCBI-ProteinID: XP_017654399
LinkDB
Position
Un
AA seq 480 aa
MSEMENWIKLPGCQHIMDTKCDFSSANLDVYEEVKLRLRAEQGNSSSSWIEVDSFVPFKI
AHVGPPAVHLEAEDKAIVIYITRPGKGGNMWALDDLGFTYSIDIWSNSSGVEKTVKTSYL
TDKIFSLLPETTYCLKVKAVQIGLGRHGAYSPVHCINTTVANKVPAPENVKVYADSKNYV
LTWDYAYTNVTFKAQWLLAYLKLSPGNYSDKWRPIPSCENVRTMRCVFPRDTVPRGILFL
HVQASDGNNTSFGSEEKRISCDEYTVIPTPVVDMKPTSDSLFVSVRSIDNSRCKFHELVY
EFIFWENTSNTERTEVKKIPTLTLHNLQPLTVYCLKARALVISIGNNSSDFSNTVCEKTT
PGNSSITWIIPGVFAIAVFVVIVVNILLNCLKYIFFPSLKPPLSIDEYLSEPPLKHLLLL
TSEEQTEKCFIVENTDKLVVGEEKNTPDDDHKRYTSQTSQDSGNYSNEEENGASESSGGF
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgtcagagatggagaactggataaagctgcctgggtgtcagcacattatggacaccaag
tgtgacttttcttcagccaacctagatgtctatgaggaagttaagttgcgtctaagagca
gaacaaggaaacagctcttcttcatggattgaggttgactcatttgtgccatttaaaata
gctcacgttggtcccccagcagtgcatttagaagctgaagataaggcaatagtaatatac
atcactcgtcctggaaaaggtggtaacatgtgggctctggatgatttggggttcacatac
agcatagacatctggagcaactcttcaggtgtagagaaaacggttaaaactagctatctc
acagataagatttttagcctgttaccagagactacctactgtttaaaagttaaagcagta
cagattgggcttgggagacatggtgcctatagtccagtgcattgtataaacaccacagtg
gcaaataaggtgcctgcaccagaaaatgtgaaagtatatgctgacagtaagaactacgtt
ctgacatgggattacgcatacacaaacgtcacctttaaagctcagtggctccttgcctac
ttaaagttgtctcctgggaactattcggataagtggagacccatacctagctgtgaaaat
gtcagaacaatgcgctgtgtctttcctcgagatactgtcccaagaggaattctctttctt
catgtacaagcatcagatgggaataacacatcctttgggtctgaagagaaaagaatcagt
tgtgatgaatacaccgtcataccaactccggttgttgacatgaaacccactagtgattcg
ctgtttgtctctgtccgttctatagacaattccaggtgcaagtttcatgaactagtttat
gaatttattttttgggaaaacacttcaaatactgagagaacagaggtgaaaaaaatcccc
acgcttactctgcataacctacaacccctgacagtgtactgcttgaaagccagagcgctc
gtgatttccatagggaataatagcagtgatttcagcaacactgtatgtgagaagacaaca
ccaggaaattcttccataacctggattatacctggagtttttgccattgcagtttttgtt
gtcattgttgtgaatatcctcctgaactgtctcaagtatatattctttccatcactgaaa
cctcctctcagcatcgatgagtatctctctgagccacctttaaagcatctccttcttttg
acgtctgaggagcaaactgaaaagtgttttatcgttgagaacacagacaagcttgttgtg
ggagaagaaaagaacacacctgatgatgatcacaaaaggtacacatcccagacaagccaa
gattcagggaactattccaatgaggaagagaatggggccagtgagtccagcgggggcttt
tag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736456
Entry
103736456         CDS       T03372                                 

Gene name
Il10rb
Definition
(RefSeq) interleukin 10 receptor subunit beta
  KO
K05135  interleukin 10 receptor beta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04630  JAK-STAT signaling pathway
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103736456 (Il10rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103736456 (Il10rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103736456 (Il10rb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103736456 (Il10rb)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103736456 (Il10rb)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103736456 (Il10rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103736456 (Il10rb)
   04090 CD molecules [BR:ngi04090]
    103736456 (Il10rb)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL10/28 receptor family
   103736456 (Il10rb)
CD molecules [BR:ngi04090]
 Proteins
  103736456 (Il10rb)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 zf-MIZ SUR7 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 103736456
NCBI-ProteinID: XP_008834187
LinkDB
Position
Un
AA seq 351 aa
MAWARSLAGWLGIWLLVSALGMIPPPENVKMNSVNFKSVLQWEPPAFPKENLTFTAQYLS
YWGFQDVCKNTTITECDFSILSKYGDHTLRVRAEFADEHSDWVNITFCPVEDTIIGPPRM
HIEMLADSLHMRFLAPEVENEPETWTMKNFYDSWAYKVQYWKNGTDEKFEVTTQYDFEVL
RDLEPQTTYCIQVQGFLPVQNKAGKWSEPVCKQTATDETTPSWMVALILIASVFVVFLFL
LGCFALLWFIYKKTKHTFPSGNSLPQHLKEFLGHPHHSPLLFFSFPLSDENEVFDKLSVI
TEDCEGSKQNPRVSWTLEVPSKPGPQEDDSKDEALSVGHSDPLLLTSDSEV
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggcctgggcgcggagcctcgccggctggctgggcatctggctgctggtgtcagcatta
ggaatgataccaccccctgaaaatgtcaagatgaattcagttaatttcaagagcgttcta
caatgggagccacctgctttccccaaagagaatctgactttcactgctcagtacctaagt
tattggggttttcaagatgtatgcaagaacactaccatcacagaatgcgacttctcaatt
ctttctaagtatggcgaccacaccttaagagtcagggctgagtttgcagacgaacattcg
gactgggtaaacatcaccttctgtcctgtggaagacaccattattggacctcctcgaatg
cacatagaaatgcttgctgattctttacatatgcgtttcttagccccagaagttgagaat
gaacctgaaacatggaccatgaagaacttttatgactcatgggcctataaggtgcaatat
tggaaaaatgggactgatgagaagtttgaagttactactcagtatgactttgaggtcctc
agagacctggagccacagacaacttactgcattcaagtccaagggtttcttcctgtacag
aacaaagctgggaagtggagtgagcctgtctgtaagcagacagccactgacgaaacgacc
ccttcctggatggtggccctcatcctcatagcctcggtctttgtggtcttcctgttcctt
ctcggctgctttgccttactgtggttcatttataagaaaaccaagcacaccttcccctct
gggaattctcttccacagcacctgaaagagtttctgggccaccctcatcacagcccactt
ctgtttttctccttcccgctctctgatgagaatgaagtttttgacaaactaagtgtcatc
accgaagactgtgaaggcagcaaacagaatcctagggtcagctggaccctggaggtccca
tcaaagccaggacctcaagaggacgattccaaggatgaagccctctcagttgggcatagt
gaccccttgcttctcacatctgactcagaggtgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736458
Entry
103736458         CDS       T03372                                 

Gene name
Ifnar2
Definition
(RefSeq) interferon alpha and beta receptor subunit 2
  KO
K05131  interferon receptor 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04217  Necroptosis
ngi04380  Osteoclast differentiation
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi05160  Hepatitis C
ngi05162  Measles
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103736458 (Ifnar2)
   04151 PI3K-Akt signaling pathway
    103736458 (Ifnar2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103736458 (Ifnar2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103736458 (Ifnar2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103736458 (Ifnar2)
   04621 NOD-like receptor signaling pathway
    103736458 (Ifnar2)
   04650 Natural killer cell mediated cytotoxicity
    103736458 (Ifnar2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103736458 (Ifnar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103736458 (Ifnar2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103736458 (Ifnar2)
   05171 Coronavirus disease - COVID-19
    103736458 (Ifnar2)
   05164 Influenza A
    103736458 (Ifnar2)
   05162 Measles
    103736458 (Ifnar2)
   05168 Herpes simplex virus 1 infection
    103736458 (Ifnar2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103736458 (Ifnar2)
   05169 Epstein-Barr virus infection
    103736458 (Ifnar2)
   05165 Human papillomavirus infection
    103736458 (Ifnar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103736458 (Ifnar2)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IFN receptor family
   103736458 (Ifnar2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 103736458
NCBI-ProteinID: XP_008834189
LinkDB
Position
Un
AA seq 524 aa
MFSNYNVSAITLLNLYLMVYVSVLFGTSPTFSEYSDESCTMNLTIQNFQLILSWEVKNRS
IQPTHYTLWYTIMSKPEDPKIVGNCTNITKPSCDLTDVWEIMDDHYIPIVELYKGNSMVG
RCMNSFWASDFYIEPPRFEIVGFLDHINVTLEFPSVTPKIYGKEIQEYASLVIEKQWDKI
VKLNDLKLNRDFSGNFTYILDNLIPNTNYCVSVYFEPLDVEKIIKSPIKCIFLQPDQESG
LSISAKIGIIITGWIVLFFISSILMLRRTGYICLKNNFPKVLNFHNFLASMFAEPPPSEA
VDMLEIIHTNKKKKLWNYSYGDESDSEEEEEEVPKASATGYTTHGLMGKHLSQAPDPSAS
SQESQCEDSAVEESDEPGAELEPPREARPDPWQPESSRSPRERRERVLQDSYPRHNSSST
DEPGDKVIFNVNLNSVFLRVLDDDSEEDSQETSEVLPLAEDTIDLEEDPHRIESSLLMAS
GERTQPPHHSSSSQCLWTEEESSDKTDSSGSDTDADVGDGYIMR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgttttcaaactataatgtctccgccatcactttacttaacttgtatctcatggtgtat
gtgagtgtgctgtttggtacgtcacctactttcagtgagtattcagatgaatcttgcact
atgaacctgacaatacaaaatttccagctaattttatcatgggaagtaaaaaacagatcc
atccagccaactcactatacattatggtacacaatcatgagcaaaccagaagatccaaag
attgttgggaactgcacaaatatcacgaaaccatcatgtgacctgacagatgtatgggaa
atcatggatgaccactacatacccatagtggagctatacaaagggaactccatggtgggc
cgttgtatgaacagcttctgggcctcagacttttatattgagccaccaagatttgaaatt
gttggcttcttagaccacattaatgtaacactggaatttccatctgtcactcccaagata
tatgggaaggaaatacaggaatatgcgtcgcttgtcatcgaaaagcagtgggacaaaatc
gttaagttgaatgacctcaaactaaatagagacttcagtggaaatttcacctacattctg
gacaacttaattccaaacaccaactattgtgtatctgtttattttgaacctctagatgtg
gaaaaaataataaaatctcccataaaatgcatcttccttcagcctgaccaggaatcagga
ctatcaatatctgccaaaataggaattattattactgggtggatagtgctgttcttcata
agtagcatcctaatgctgagacggactggctatatatgcttaaaaaacaatttccccaaa
gtgttgaatttccataactttttagcctccatgtttgctgagccaccaccatcagaagca
gtagacatgctggagatcattcacaccaacaaaaagaagaagctgtggaattatagttat
ggagatgaaagtgacagtgaagaagaagaagaagaagtgcccaaagcaagtgccactggt
tataccacgcatgggctgatgggcaagcatctgagccaagcccctgacccctcagccagc
tcccaggaatcccagtgtgaagactcagctgttgaagagtctgatgaacctggggctgag
ctggagccccccagggaggcaaggcctgacccctggcagccagaaagttccagaagcccc
cgtgagaggagagagcgtgtgctccaggactcctatcccagacacaacagcagctctaca
gatgagcctggggacaaagttatcttcaatgtgaatttaaactctgtgtttctgagagtt
ctcgacgatgactctgaagaagactctcaggaaacctctgaggtgttgcctcttgcagaa
gataccatcgacctagaagaggatccccacaggatagagtcaagccttctaatggccagt
ggggaaaggacacagccaccccaccacagctcctcttcccagtgcctgtggactgaagag
gagtcatctgataaaactgactcttcaggttctgatactgatgctgatgtaggggatggt
tatataatgagatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739911
Entry
103739911         CDS       T03372                                 

Gene name
Il6st
Definition
(RefSeq) interleukin 6 signal transducer
  KO
K05060  interleukin 6 signal transducer
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04630  JAK-STAT signaling pathway
ngi04659  Th17 cell differentiation
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103739911 (Il6st)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103739911 (Il6st)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103739911 (Il6st)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103739911 (Il6st)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103739911 (Il6st)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103739911 (Il6st)
   05203 Viral carcinogenesis
    103739911 (Il6st)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103739911 (Il6st)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103739911 (Il6st)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103739911 (Il6st)
   04090 CD molecules [BR:ngi04090]
    103739911 (Il6st)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL6/12 receptor family
   103739911 (Il6st)
CD molecules [BR:ngi04090]
 Proteins
  103739911 (Il6st)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 Pur_ac_phosph_N EpoR_lig-bind IL6Ra-bind Interfer-bind fn3_2 IL4Ra_N
Other DBs
NCBI-GeneID: 103739911
NCBI-ProteinID: XP_008838604
LinkDB
Position
Un
AA seq 919 aa
MSTLRIWLVQALVIFLTAESIAQLLDPCGYIYPESPVIQRGSNFTAVCVLKEECLERYHV
NATYIVWKTNHVAVPKEQYTIINRTTSSVTFTNMASLSVQLTCNILTYGQLEQNVYGINI
LSGFPPDEPKNLSCIVNEGKKMMCQWDPGRETYLETNFTLKSEWATEKFDDCVTKRGTPT
LCLVNYPPVYFVNIEVWVEAANALGKVTSEHINFDPVDRVKPNPPRNLTVNTSEEMSTIL
KLTWINPSIKNVIRLKYNIQYRTKDASTWSQVPPEDTVATRSSFTIQDLKPFTEYVFRIR
CMKEDNKGFWSDWSEEAHGITYEDRPSKAPSFWYKINPSHIQEYRSVQLIWKTLPASEAN
GKILDYEVIVTQWKSFSQNYTVNDTELIVNLTHNRYVITLTARNLVGKSDAAVIIIPGQH
FKASHPVVDLKAFPKDNMLWVEWTAPHKYVRKYILEWCVLSDKLPCIPDWQQEHGSVHQT
YLRGNLVASKCYLITVTPVYSIGPGSPESVKAYLKQAAPSKGPIVRTKKVGKNEAVLEWD
RLPVDVQNGFIRNYSIFYRTIVGNETVVNVDSSHTEYTLSSLSSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHNFNSKDQIYSDGNFTDVSVVEIEANDKKPCPDDLKSLELFKKEKIS
TEGHSSGIGGSSCMSSSRPSISSSDENESAQNTASTVQYSTVVHSGYRHQVPSVQVFSRS
ESTQPLLDSEERPDDLQLVDNVDISGDILPRQQYFKQNCSQSETSPDISHFERSDQISSG
NEEDFVRLKQQQVSDHISQSCGAEQMKMFQEVSATGAFGPVTEGQVEQFEPVGMEAAIDE
GIPKSYLPQTVRQGGYMPQ
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgtcgacattgaggatttggctagtgcaagctttggttattttcctcaccgctgaatct
atagctcagcttctggatccatgtggttatatctaccctgaatctccagttatacagcgt
ggctctaacttcactgcagtttgtgtgctaaaggaagaatgtctggagcggtaccatgta
aatgccacctacattgtctggaaaacaaaccatgttgctgttcctaaggagcaatatact
attatcaacagaaccacatccagcgttaccttcacaaatatggcttccctgagtgtccag
ctcacatgcaacattctgacttatgggcagcttgaacagaatgtgtatggaatcaatata
ctttcaggatttcctccagatgaacctaaaaatttgagttgcattgtgaatgagggaaag
aaaatgatgtgtcaatgggaccctggaagggagacatacttggaaacaaacttcacttta
aaatctgagtgggcaacagagaaatttgatgattgtgttacaaaacgtggcacccccacc
ttatgccttgtcaactaccctcctgtctattttgtcaacattgaagtctgggtagaagcg
gcaaatgctcttggcaaggtgacctcagagcatatcaatttcgatcctgtggatagagtg
aagcccaacccaccacgtaatttaacagtgaatacctcagaggaaatgtccactatatta
aagttaacatggatcaatccaagtattaagaatgttataagactgaaatacaacattcaa
tataggaccaaagatgcctcaacttggagccaggtccctcctgaagataccgtggctacc
cgatcttcattcactattcaggaccttaaaccttttacagaatatgtattcaggattcgc
tgtatgaaggaggataacaagggcttctggagtgactggagtgaagaagcacatgggatc
acatatgaagatagaccatccaaagcaccaagtttctggtataagataaatccatcccat
attcaggaatatagatctgtacagctcatatggaagacattgcctgcctctgaagccaat
ggaaaaatcttggattatgaagtgattgttacacagtggaaatcattttcacaaaattac
acggttaatgacacagaattgatagtaaatctcacacataatcgctatgtgataactcta
acagcaagaaatcttgttggcaaatcagatgcagctgtcataattatccccggccagcac
tttaaagcttctcaccctgtagtggatcttaaagcattcccaaaagataacatgctctgg
gtagaatggactgctccacataaatatgtgaggaagtacatacttgaatggtgtgtgttg
tcggataaattgccctgtatcccagactggcaacaagaacatggcagtgtgcatcaaacc
tatttaagaggaaacctagtggcgagcaaatgctatctgatcacagttactcctgtgtat
tccatcggaccaggaagcccagagtctgtgaaggcttacctcaaacaagctgcaccttcc
aaaggacctattgttcgaacaaaaaaagtggggaaaaatgaagctgtcttagaatgggac
cgacttcctgttgatgttcagaatggatttattagaaattattctatattttatagaacc
atcgttggaaatgaaactgttgtgaatgtggattcttcccacacagaatacacattgtcc
tctttgagtagtgatacgctgtacatggtacggatggcagcatatacagatgaaggtgga
aaagacggtccagaattcacttttacaacaccaaagtttgctcagggagaaatagaagcc
atagttgtgcctgtttgcttagcattcctgttgacaacccttctgggagtcttgttctgc
tttaataaacgagacctaattaaaaaacacatctggcctaatgttccagatccttcaaag
agtcatattgcccagtggtcacctcacacacccccaaggcacaattttaattccaaagat
caaatatattccgatggcaattttactgatgtaagtgttgtggaaatagaagcaaatgac
aaaaagccatgcccagatgatctgaagtcattggaactgttcaagaaggaaaaaattagt
acggaaggccacagcagtggcatcgggggctcttcctgcatgtcgtcctccaggcccagc
atctctagcagtgatgagaatgaatctgcacagaacactgcaagcactgtccagtattca
actgtggtacacagtggctacaggcaccaggttccatcagtgcaagtcttctcaaggtct
gagtccacacagcccctgttagattctgaggagcgcccagatgatctacagttggtagat
aatgtcgacatcagtggtgacattttacccaggcaacagtatttcaaacagaactgcagt
cagtctgaaaccagtccagatatttcacattttgaaagatcagaccaaatttcatcaggc
aatgaggaagattttgttagactgaaacagcagcaggtttcagatcatatttcacagtcc
tgtggagccgaacaaatgaagatgtttcaggaagtttctgcaacaggtgcttttggccca
gtgactgagggacaagtagaacaatttgaacctgttggaatggaggcagcaattgatgaa
ggaatccctaaaagttacttgccacagactgtaagacagggtggctatatgcctcagtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740877
Entry
103740877         CDS       T03372                                 

Gene name
Il13ra2
Definition
(RefSeq) interleukin 13 receptor subunit alpha 2
  KO
K05077  interleukin 13 receptor alpha-2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103740877 (Il13ra2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103740877 (Il13ra2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103740877 (Il13ra2)
   04090 CD molecules [BR:ngi04090]
    103740877 (Il13ra2)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL3 receptor family
   103740877 (Il13ra2)
CD molecules [BR:ngi04090]
 Proteins
  103740877 (Il13ra2)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind LIFR_N
Other DBs
NCBI-GeneID: 103740877
NCBI-ProteinID: XP_008839788
LinkDB
Position
Un
AA seq 385 aa
MAFMCVDTRCLCILLICTAIGHTLEIKVNPPQDFEILDPGLLGYIYLQWKPPVAIEKLNE
CTLEYELKYRNVDSESWKTIITKNLFYKDGFDLNKGIEGKIRTHLPKQCANGSEIQSSWT
EASYQISDQGSLETKIRDMNCIYYNWQHLVCSWKPGKRVHYDTNYTMFFWYEGLDHALQC
VNYLQENTKNIGCKLSNLESSDYKDFFICVNGSSDFEPIRSSYYIFQLQNIVKPFPPDFL
HITVENSVEIKMKWSTPGGPIPARCYTYEIVFREDDFSWVSVTDKTDMKMKRKANESKDL
CFLVRSKVNMYCSDDGIWSEWSEERCWEVYTRTNSRIIFIIPVCLFFVFFLFLLCLVLEK
EEPDPTLSFHVQLEKEVYSYEETLC
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggcttttatgtgtgtggatacaaggtgcctgtgtatccttttaatttgcacagcaatt
ggccatactttggagataaaagttaatcctccccaggattttgaaatactggatcctgga
ttattaggctacatctatttacaatggaaacctcctgtggctatagaaaaacttaacgaa
tgcacactagaatatgaattaaaataccgaaatgttgatagtgaaagttggaagaccatc
attactaagaatctattttacaaagatgggtttgatcttaacaaaggcattgaaggaaag
atacgaacacatttgccaaagcagtgtgcaaacggatcagaaattcaaagttcatggaca
gaagcttcttatcagatatcagaccaaggaagcttggaaactaaaattcgggatatgaat
tgtatatattacaactggcaacatttggtttgttcttggaagccaggcaagagagtgcat
tatgataccaactataccatgttcttttggtatgaaggcttggatcatgccttgcagtgt
gtcaattatctccaggagaacaccaaaaatattgggtgcaaactttccaacttggagtca
tcagactataaagatttttttatctgtgtcaatggatcatcagattttgaacctatcaga
tccagctattacattttccagcttcaaaatatagttaaaccattcccaccagacttcctt
catattacagtggagaattcagttgaaatcaaaatgaaatggagcacacctggaggaccc
attccagcacggtgttacacttatgaaattgtattccgagaagatgatttttcctgggtg
tctgtcacagataaaactgacatgaagatgaaaaggaaagcaaatgaaagtaaagatcta
tgctttcttgtaaggagtaaagtgaatatgtactgttcagatgatggaatttggagtgaa
tggagtgaagaacgatgctgggaagtgtatacaaggacaaactcaaggataattttcata
ataccagtgtgtcttttctttgtattttttttatttctactttgccttgttttggaaaag
gaagaacctgacccgacattgagtttccatgtgcagctggagaaagaagtttattcttat
gaagagacactctgttaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740975
Entry
103740975         CDS       T03372                                 

Gene name
Il20rb
Definition
(RefSeq) interleukin 20 receptor subunit beta
  KO
K05137  interleukin 20 receptor beta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103740975 (Il20rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103740975 (Il20rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103740975 (Il20rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103740975 (Il20rb)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL10/28 receptor family
   103740975 (Il20rb)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 103740975
NCBI-ProteinID: XP_008839877
LinkDB
Position
Un
AA seq 311 aa
MLLEGIWISLIMWFIYALISCLSTDGVVVLPAPQNLSIQSANMKHLLTWSPVIMPGETVF
YSVEYQGEYESLYTSHIWIPSSWCSPTKGPECDVTDDITATVPYNLRVRATLGSQTSAWS
TLEHPFNRNSTVLTPPRMEVTKDGLHLVIELEDLGPHFEFLVVYWREEPGAKEHVKVMTG
GLPVHLETMEPGAMYCVKAEALVKAIGKHSAFNQAECVEVQGESLPLVLALFAFVGFMLI
LVVVPFSFWKMGQLLRYSCCPTVVLPDTLKIPSSSQKLIACRKEEMDACDVAVLSSEQFF
QAWISQKSPVE
NT seq 936 nt   +upstreamnt  +downstreamnt
atgcttctagaaggaatctggataagtcttatcatgtggtttatctacgccttgatttca
tgtttgtccacagatggagtggttgttctgcctgccccacagaacctctctatacaatca
gccaacatgaagcacctgttgacgtggagcccagtgatcatgcctggagagacggtattc
tattctgtggagtaccagggggagtacgagagcttgtacaccagccacatctggattccc
agcagctggtgttcacccaccaaaggtcctgagtgtgatgtaactgatgacatcactgcc
acagtgccatacaacctcagagtcagggccacactgggctcacagacttcagcctggagc
actctggagcaccccttcaatcgaaactcaactgtccttaccccacccaggatggaggtc
accaaggatggcttgcacctggttattgaactggaagacctggggccccactttgagttc
cttgtggtgtactggagggaggagcctggtgccaaggaacatgtcaaggtgatgactggg
ggccttcctgtgcacctggaaaccatggaaccaggggctatgtactgtgtgaaggccgag
gcgctggtgaaagccattgggaagcacagtgccttcaaccaggctgagtgtgtggaggtg
caaggagagtctctcccattggtgctggctctattcgcatttgttggcttcatgctcatc
cttgtggtggtgcctttctccttctggaagatgggccagctgctccggtactcctgctgc
cctactgtcgtcctcccagacaccttgaaaatacccagttcatcccagaagctaattgcc
tgcagaaaggaggagatggatgcctgtgatgtggcggtgctgtcctcagagcaattcttc
caggcctggatctcacagaagagccctgtggagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741011
Entry
103741011         CDS       T03372                                 

Gene name
Il4r
Definition
(RefSeq) interleukin 4 receptor
  KO
K05071  interleukin 4 receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi05200  Pathways in cancer
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103741011 (Il4r)
   04151 PI3K-Akt signaling pathway
    103741011 (Il4r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103741011 (Il4r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103741011 (Il4r)
   04658 Th1 and Th2 cell differentiation
    103741011 (Il4r)
   04659 Th17 cell differentiation
    103741011 (Il4r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103741011 (Il4r)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103741011 (Il4r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103741011 (Il4r)
   04090 CD molecules [BR:ngi04090]
    103741011 (Il4r)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL2 receptor family
   103741011 (Il4r)
CD molecules [BR:ngi04090]
 Proteins
  103741011 (Il4r)
SSDB
Motif
Pfam: IL4Ra_N
Other DBs
NCBI-GeneID: 103741011
NCBI-ProteinID: XP_008839928
LinkDB
Position
Un
AA seq 796 aa
MSLMGWLRARLLLSVLSVNCLILLWAVGSGSIKVLSEPTCFSDYINTSTCEWQLDGVVNC
SSELRLAYWLDFEFPENITCVPKNSASTACMCDDMYTDDLVEADTYQLDLWAGQRLLWQG
SFRPSNHVKPRVPGNLMVHTNVSSAWLLTWNNPYPPGNFLHDRLTYMVNVSRADDPEDFT
VYNVTYRGANLLLLANTLKSGVSYTAQVRVWAQSFNSTWSEWSPSIKWYNHFQPSLAQRL
PLGVGVSCVGILLVCLSCYVCISRVKKMWWDQIPTPARSPLVAIIIQDSKVSLWQKQAQS
QEPTKCPRWKSCLTKLLPCLLEHSMKRAAKTGPLQGPGKPAWCPVEVSRTVFRPENVSMS
VVQCMEVFEAPGESEEEEEEDLCTLPEDSISDFQEGRAGIVARLTENLFIDLLGPEDRGF
DQPALGESCFTLPSESGQDPVPWACFPTGPKEATCWATEQPLHSEPPPGSPTHSTASLAC
TQVPVITDNPAYRSFSHFQSQSPGPGELAPDPLQAGHLEEGDSPNPGVPCSSGPPMQQTE
SESWEQILHLSVLRHRAAVPAPASGYREFVQAVREGAAQDPGVAGLGPCRDSGYKAFSSL
LTNNSLCRGTAGPEAGNGDGGYKPFQNLIPDPSPSSVPLFTFGLDTEPPPNPPDSPLPSS
IPECLGLEPELKGGNVQKAPLPTEPLGDDLGLGIVYSALTCHLCGHLKQHHSQEESGQVR
MVASPCCGCCCGDRSPPGSSSGSLDTSPQGLPQEASLTPASRAPSGFSGEGKATGHTQGT
KVKGLVSEGAQGVIVS
NT seq 2391 nt   +upstreamnt  +downstreamnt
atgtccctaatggggtggcttcgtgcccggctcctgctctctgtgctctctgtgaactgc
ctgatcctgctgtgggcagtcggctctgggagcatcaaggtcctgtctgagcccacctgc
ttctccgattacatcaatacctccacctgtgagtggcaactggatggcgttgtcaactgc
agctcagagctccgcctggcctactggctggacttcgaattccctgaaaacatcacgtgt
gtccccaagaacagcgccagcacggcgtgcatgtgcgacgacatgtacacggacgacctt
gtcgaggcagacacgtaccagttggacttgtgggcaggacagcgactgctgtggcagggt
tccttcagacccagcaaccatgtgaagccccgggtcccaggcaacctcatggtccacacc
aatgtctccagtgcatggctgctgacgtggaacaacccatacccgccagggaacttccta
cacgacaggctcacctacatggtcaatgtctccagagcggatgatcctgaagatttcaca
gtctataacgtgacctacaggggtgccaatctgctcctcctagccaatactctgaagtca
ggggtatcctacacggctcaggtgagagtctgggcccagagcttcaacagcacctggagc
gagtggagcccaagcatcaagtggtacaaccacttccagccgtccctggcccagcgcctc
ccactgggggttggtgtctcctgtgtcggcatcctgttggtctgcctgtcctgctatgtc
tgtatcagcagggtgaagaaaatgtggtgggatcagattcccacccctgcacgcagcccc
ctggtggccatcatcatccaggactcaaaggtgtccctatggcaaaagcaagcccaaagc
caggagccaaccaagtgcccacgctggaagagttgtctgaccaaactcctcccctgcttg
ctggagcatagcatgaagagggctgccaaaactgggcctctccagggtcctggaaagcca
gcttggtgtcctgtggaggtcagcaggacagtcttccggccagagaatgtcagcatgagt
gtggtgcaatgtatggaggtttttgaggccccaggagagagtgaggaggaagaggaagag
gacttgtgcacattacctgaggacagcatcagtgacttccaggagggcagggcaggcatc
gtggctcggctgactgagaacctgttcatagacttgttggggcctgaggacaggggcttt
gaccagccagccttgggggagtcatgcttcactctgccttcagaaagtggacaggaccct
gtgccctgggcctgcttccccacagggcccaaggaggccacctgctgggccacagagcag
cctttgcactcagagcctcctccaggcagcccaacccacagcacagccagtctggcctgc
acgcaggtgccggtcattacagacaaccctgcctaccggagcttcagccacttccaaagc
cagtctccaggccctggagagctggccccagaccctctgcaggctggacatctggaggaa
ggggactccccaaaccctggtgtgccctgttcttcaggaccacccatgcagcagacagag
tcagaaagctgggagcagatccttcacctgagcgtcctgcggcacagggccgctgtcccg
gctcccgccagtggctaccgggagtttgtgcaggcggtgagggagggcgctgcccaggac
cctggggtagctgggctcgggccctgcagagactctggttacaaggccttctccagtctg
ctaaccaacaattccctctgcagggggacagcaggaccggaggctggcaatggggatggg
ggctataagcccttccagaacctcattcctgacccatcccctagctctgtgcccctattt
acctttggactggacacagaaccaccacccaaccctccagactctcccctacccagcagc
attccagaatgccttggtctggagccagagcttaaaggaggcaatgtgcaaaaggcgcct
ctccctacagagccacttggggacgacctgggcctcggcatcgtctactctgccctcacc
tgccacctgtgtggccatctgaagcagcaccatagccaggaggaaagtggccaggtccgc
atggtggccagcccctgctgtggctgctgttgtggggataggtcacccccaggaagctcc
tcagggtccctagacacttctcctcaagggttgccacaggaagccagcctcactccagca
tccagggcaccctcaggcttttcaggggagggcaaggccactggccatactcaagggacc
aaggtgaagggcctggtgtccgagggggcccagggtgtgatagtttcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741072
Entry
103741072         CDS       T03372                                 

Gene name
Il21r
Definition
(RefSeq) interleukin 21 receptor
  KO
K05075  interleukin 21 receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04659  Th17 cell differentiation
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103741072 (Il21r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103741072 (Il21r)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103741072 (Il21r)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    103741072 (Il21r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103741072 (Il21r)
   04090 CD molecules [BR:ngi04090]
    103741072 (Il21r)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL2 receptor family
   103741072 (Il21r)
CD molecules [BR:ngi04090]
 Proteins
  103741072 (Il21r)
SSDB
Motif
Pfam: IL4Ra_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 103741072
NCBI-ProteinID: XP_008839979
LinkDB
Position
Un
AA seq 521 aa
MPSGWGCLDLTCYTDFLWTVTCVLEMQGLQPSILTLTWKDEYGELDDEVTSCSLSRSSYN
TTHAWFTCRMPVFHFMADDIFSVNMTDQSGNNSQECGSFVLAENIKPAPPFNVTVTFSGH
YVVSWHSDYEAPTFYPLRGKLQYELWYWDLGDPWAMRLVTKLISVDLGHVSLLPEEFHKD
SSYQLQVRAAPQTGTSFKGTWSEWSDPVIFQTQASEPKAGLDLRLLLFLLVVLAPVLVFL
GLKIHVPWRLWKKVWAPVPSPKSFFQPLYREHSGDFKKWVATPFTASSLELSQSPAAASV
LQMRDNCLSPHPAKGLEFPGLLGLEEQLECDGVSESGHWGMAPSAAGPGGSVYSEEKERP
YGLLSIDTVTVGDAEGPCTWACTCGDDGYPALNLDIGPESGPSAKDLLLVTGTTLLSCGC
VSGGGLGLGSSPSNLLDRLKLPLAEEGDWAAGPPWGDGSPGEGSESEVGSPPGLDMDTFD
SGFAGSECGSPVESDGGPPRSYLRQWVVRTPASADSGPQAS
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgccctcaggttggggctgcctggacctcacctgctacactgacttcctgtggactgtt
acctgtgtcctggagatgcagggcctccaacccagcatactcactctcacctggaaagac
gagtatggggagctggatgacgaggtcacctcctgcagcctgagcaggtccagctacaac
accacgcatgcatggttcacgtgccgcatgcctgtgttccatttcatggctgatgacatt
ttcagtgtcaacatgacagaccagtctggcaacaactcccaggagtgtggcagctttgtt
ctggctgagaacatcaagccagctccccctttcaatgtgaccgtgaccttctctggacac
tatgttgtctcctggcactcggattacgaagcccctaccttctacccgctgaggggaaaa
ctgcagtatgagctgtggtattgggacctgggggacccctgggctatgaggctggtgacc
aagctgatctcagtggacttgggccatgtctccctcctccctgaagagttccacaaagac
tccagctaccagctgcaagtgcgggcagcaccccagactggcacctccttcaaggggacc
tggagcgagtggagtgaccctgtcatctttcagacccaagcttcagagcccaaggcaggc
ttggaccttcgcctgctgctgttcctactggttgtcttggcccctgtcctggttttcctg
ggtctgaagatccacgtgccttggaggctgtggaagaaggtatgggcgccagtgcctagc
cccaagagtttcttccagcccctgtacagggaacacagcggggacttcaagaaatgggtg
gccacccctttcacggcctccagcctggaactgtcccagagccccgcagcagcgtctgtc
ctacagatgcgtgacaactgcctgtcaccacatccagccaagggactggagttcccagga
ctgctgggtctagaagagcagctggagtgtgatggggtgtctgagtctggccactggggc
atggccccctcagcagctggcccagggggctcagtctacagtgaagagaaggaacggcca
tatggcctgctgtccatcgacacagtgactgtgggggatgcagagggtccatgcacctgg
gcttgtacctgtggggatgatggctacccagctctgaacctagacattggcccagagtca
ggccccagtgcaaaggacctgctcctggtcacagggacaacactcctatcatgtggctgt
gtctcaggaggtggccttgggctgggcagctcacccagcaacctcctggacaggttgaag
cttccccttgctgaggaaggggactgggcagcaggaccaccctggggagatgggtcccca
ggagagggctctgagagtgaggtgggctcacccccgggcctggacatggacacctttgac
agcggctttgcaggctcagagtgcggcagcccagtggagagtgatggagggcctccgcgt
agctacctccgccagtgggtggtcaggacccctgcatctgccgacagtggaccccaggcc
agctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741311
Entry
103741311         CDS       T03372                                 

Gene name
Il7r
Definition
(RefSeq) interleukin 7 receptor
  KO
K05072  interleukin 7 receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04068  FoxO signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi05200  Pathways in cancer
ngi05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103741311 (Il7r)
   04068 FoxO signaling pathway
    103741311 (Il7r)
   04151 PI3K-Akt signaling pathway
    103741311 (Il7r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103741311 (Il7r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103741311 (Il7r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103741311 (Il7r)
  09163 Immune disease
   05340 Primary immunodeficiency
    103741311 (Il7r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103741311 (Il7r)
   04090 CD molecules [BR:ngi04090]
    103741311 (Il7r)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL2 receptor family
   103741311 (Il7r)
CD molecules [BR:ngi04090]
 Proteins
  103741311 (Il7r)
SSDB
Motif
Pfam: FN3_7 fn3 Vps55
Other DBs
NCBI-GeneID: 103741311
NCBI-ProteinID: XP_008840285
LinkDB
Position
Un
AA seq 457 aa
MTILGISSGMIFCLLQAVSGESGNAQNGDFEDAELDDYSFWCYSQLEVDGSQDSLTCAFD
DPDINSTNLEFQICGALMEINCLTLNKLEDKYFIKTTKFVLVGKSNVCVKLREKNLTCKS
VEIFKIVKPEVPFDLKVVYREEANDFLVTFNTTHMQKMYVKQLMHEMAYRLEKDENKWMN
VNLFNTRVTLPQRKLQPDSMYEIKVRSIPQNKYFEGFWSEWSPSSYFRTPETKSPGGWHP
VLSTISISSFFSVVLLVILACALWKKRIKPIVWPSLPDHKKTLEQLCKKPKKNLNVSFNP
ESFLDCQIHEVNDVQARDEAESFLQNALPPQPWDSEKQDHEAAEHSRNLPPEMSVSIPET
FRAESPLRCLTRNLSACDTPVCPSSRSPHCRDDGRNGPHMCPGLLLSPGIVNSTLPPPFP
RQSGILTPVAQRQPILSSSASNQEEAYVTMSSFYQNQ
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgacgattctaggtatatcttctggtatgattttctgtttacttcaggctgtttctgga
gaaagtggcaatgcacaaaatggagactttgaagatgcagaacttgatgactactcattc
tggtgctatagccaattggaagtggatggatcccaggactcactgacctgtgcttttgat
gacccagatatcaacagcaccaatctggagtttcaaatatgtggagcactgatggaaata
aattgtctgactcttaataagctggaagacaaatatttcatcaagacaacgaaatttgta
ctggttggtaaaagcaatgtatgtgtgaagcttagagaaaagaatttgacttgcaaaagt
gtggagatattcaagatagttaaacctgaggttccctttgacctaaaagttgtttatcgt
gaagaagcaaatgactttctggtgacatttaatacaacacacatgcaaaaaatgtatgta
aaacagttaatgcatgaaatggcctaccgcctggaaaaagatgaaaacaaatggatgaat
gtaaatttattcaacacaagagtgacactcccacagagaaagttacaacctgattcaatg
tatgagattaaagtccgatccatcccacaaaacaaatattttgaaggcttctggagtgag
tggagcccaagttcttactttagaactccagagaccaagagtccaggaggatggcatcct
gttctgtcaacaatcagcatttcaagttttttctctgtggtgctgttggtcattttagcc
tgtgcattgtggaaaaaaagaattaaacctattgtatggcccagtctccctgatcataag
aaaactctggaacaactgtgtaagaaacctaaaaagaatttgaatgtgagtttcaatcct
gaaagtttcctggactgccagattcatgaagtgaatgacgttcaagctagagatgaagcg
gaaagctttctgcaaaatgctctccctccacaaccttgggattcggagaaacaggatcat
gaagcagctgaacacagccgaaacttgccacctgagatgtcagtcagcatacccgaaact
ttcagagcagagtcacccctaagatgcctgactagaaatctgagtgcatgtgatactcct
gtgtgcccttcttctaggtccccacactgcagagatgatggcagaaatggacctcacatg
tgcccaggcttgctactgagccctggaattgtaaacagcaccttgccaccaccatttcct
cgccaatctgggatcctgacaccagttgctcagagacagcccattctctcatcctcagca
tcaaatcaagaagaagcatatgtcaccatgtccagcttttaccaaaatcaatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741330
Entry
103741330         CDS       T03372                                 

Gene name
Lifr
Definition
(RefSeq) leukemia inhibitory factor receptor alpha
  KO
K05058  leukemia inhibitory factor receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103741330 (Lifr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103741330 (Lifr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103741330 (Lifr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103741330 (Lifr)
   04090 CD molecules [BR:ngi04090]
    103741330 (Lifr)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL6/12 receptor family
   103741330 (Lifr)
CD molecules [BR:ngi04090]
 Proteins
  103741330 (Lifr)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 IL6Ra-bind Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 103741330
NCBI-ProteinID: XP_008840308
LinkDB
Position
Un
AA seq 1099 aa
MMDVCLWWRQPSRMVDNRRTKMSPNFRWLLSVLTLLHLIMQINSQKRGVLRDLKCTTNNL
QVWDCAWKAPLGASHGTVNEVCIEDRFHSCHRLEKTNIKIPALSPGDHEVTINYLHGFES
SPSKFILNEKNVSLIPDPPEILNLSADFPTSTLHLKWNDKGSAFPPHSDAVWEIKVLRKP
SMELVKLMSFNTTLSGKDIVHHWNWTSDLPLECATHYVGIRRYIDCHHFSGRKEWSDWSL
LKNISWTPNSETKAFPQDKVILVGSNITFCCVSQTKVLSGQIGKTFCPLIHLHGESVAIH
IQNISVSENSGTNVVFTTEDNVYGTVVFAGYPPDVPQKLNCETHDLKEIICSWNPGKPTG
LVGPRNTNYTLFESFSGKYVIFERFETLTNESYQLLFQMLPNQEIHNFTLTGRNPLGQAE
STILVNITERVSPRTPTSLKVKDINSTVVTLSWHLPGNFAKINLLCQIEIYKDNSKQELR
NVAIKGVEDSSYIVAVDKLNPYTIYTFRIRCSTETFWKWSKWSNEKQHLTVEAIPSKAPD
TWREWSSDGKNLIIFWKPLPISEANGKILSYNVSCSSHEETQSLSEILDPQHKAEIQLDK
NDYIISVVAKNSVGSSPPSKIASMEIPNDDLKVEQAVGTGKRILLTWHHDPNMTCDYVIK
WCNSSRSEPCLMDWKKVPSNSTETVIESDQFQPGVRYNFFLYGCRNQGYQLLRSIIGYIE
ELAPIVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFQKGERDMPKMRSLESGH
SDIKIKNITDISQKTLRIADLQGKTSYHLVLRAYTDGGLGPEKSMFVVTKENSVGLIIAI
LIPVAVAVMVGVVTSVLCYRKREWIKETFYPDIPNPENCKALQFQKSICEGSNALKTLEM
NPCTPNNVEVLESRSIVPKIEDTEIISPVAECPEESEADPENHVVVSYCPPIIEEELANP
AADEAGGTSQVVYIDIQSMYQPQAKPEEEADIEPVVVAAVAGYKPQMRLPINSAVEETAA
EDDTDKTAGYRPQVNVNTWNLVSPDSPRSTDSNSEVVSFGSPCSINSRQFLIPPKDEDSP
KSSGGGWSFTNFFQNKPND
NT seq 3300 nt   +upstreamnt  +downstreamnt
atgatggatgtttgcttatggtggagacagccatccagaatggtggataacagaaggacg
aagatgagtcctaacttccgatggctcctatcagtacttactcttctacacctgataatg
caaataaatagtcagaagaggggggtacttcgagatttgaaatgtacaactaacaattta
caagtgtgggactgtgcttggaaagcaccccttggagccagccatggaactgttaatgaa
gtttgcattgaagacagattccattcatgccatcgattagagaaaacaaacattaaaatt
ccagctctttcacctggtgatcatgaagtaacaataaattatctacatggttttgaaagt
tctccaagtaaattcatactaaatgaaaaaaatgtttccttgattccagaccctcctgag
atcttgaatctgtctgctgacttcccgacctccacattacacctgaagtggaatgacaag
ggttctgctttcccaccccactcagatgccgtctgggaaattaaagttctacggaagccg
agtatggagcttgtaaaattaatgtcgttcaacacaactctgagtggtaaagatatagtt
caccactggaactggacatcagacctgcccttggagtgtgccactcactatgtggggatt
agaaggtacatcgactgtcatcatttctctggtcgtaaagagtggagtgactggagcctc
ctgaagaacatttcctggactccaaattctgagaccaaggcttttcctcaagataaagta
atacttgtaggctcaaacataacattttgttgtgtgagtcaaaccaaagtgctgtcggga
cagattggcaaaacattttgtcctcttatccatcttcatggggaaagtgttgcgatccac
atccaaaatatttcggtttctgaaaatagtggaacaaatgtggttttcacaacagaagat
aatgtgtatggaacagttgtctttgcaggatatccacctgatgttcctcagaaactgaat
tgtgagacacatgatttaaaagagattatatgtagttggaatccaggaaagccaacagga
ttggtgggcccacgaaatacaaattacactttgtttgaaagtttttcaggaaaatatgtt
atatttgaaagatttgaaacacttacaaatgagagctatcagttactcttccaaatgctt
ccaaatcaagaaatccacaacttcactctgactggtcgcaatccactcggacaagcagag
tcaacaatattagtcaacataactgaaagagtttctcctcgtactccaacttcattgaaa
gtaaaggacattaactcaacagttgttacactttcttggcatttaccaggaaactttgca
aagatcaatcttttatgtcaaattgaaatttataaagataattcaaaacaagaattgcgg
aatgtggcaatcaaaggagttgaagattcaagttacattgttgctgtggacaaattaaat
ccatacactatatatacttttcggattcgttgttctactgaaactttctggaaatggagc
aagtggagcaatgaaaaacaacatttaactgttgaagccattccttcaaaggccccagac
acttggagagagtggagttctgatggaaaaaatttaataatcttttggaagcctttaccc
attagtgaagctaatggaaaaatcctttcctataatgtatcatgttcatcacatgaggaa
acacagtccctttctgagatccttgatccacaacacaaagcagaaatacaacttgataaa
aatgactacatcatcagcgtggtggcaaaaaattctgttggctcatcaccaccttctaaa
atagctagtatggaaatcccaaatgatgacctcaaagtggagcaagctgttggaacaggg
aagagaattctcctcacctggcatcacgaccccaacatgacttgtgactatgtaattaaa
tggtgtaactcatctcggtctgaaccctgcctcatggactggaaaaaagttccttcaaac
agcactgagactgtaatagaatctgatcaatttcagccaggagtaagatacaattttttc
ctgtatggatgtagaaatcaaggatatcaattattacgttctattattggatatattgaa
gaattagctcctattgttgccccaaatttcactgttgaagatacatccgcagattcgata
ttagtgaaatgggaagatatccctgtggaagagcttcgaggctttttaagaggatattta
ttttactttcagaaaggagagagagatatgcctaagatgaggagcttggaatcaggtcat
tctgacatcaagataaagaatattactgacatatcccagaagaccctgagaatcgctgat
cttcaaggtaaaacaagttaccatctggtactgcgagcctatacagacggtggactgggc
ccagagaagagcatgtttgtggtgacaaaggaaaactctgtaggattaattattgccatc
ctcatccctgtggctgtggctgtcatggttggagtggtgacaagtgtcctttgctatcgg
aagcgagaatggattaaagaaactttctaccctgatattccaaatccagagaattgtaaa
gcgctgcagtttcagaaaagtatctgtgagggaagcaatgctcttaaaacattggaaatg
aatccttgtaccccaaataatgttgaagttttggaaagtcgatcgatagttcctaaaata
gaagatacagaaataatttctccagtagctgagtgtcctgaggaaagtgaggcagaccct
gaaaaccatgtggttgtgtcttactgcccaccaatcatcgaggaagaactagcaaatcct
gcagcagatgaagcaggagggacgtcccaggttgtgtacattgacattcagtccatgtac
caacctcaggccaaaccagaggaggaggcagatattgaacccgtggtggtggcggcggtg
gcaggctataagccccaaatgcgcctccccattaactctgctgtagaagagacagctgca
gaagatgacacagataagactgcaggttacaggcctcaggtcaatgtaaatacttggaat
ttggtctctccagactccccaaggtccacagacagcaacagtgaagtagtctcttttgga
agtccgtgctccatcaattcccgacaatttttgattcctcctaaagatgaggactctcct
aaatctagtggaggaggatggtcctttacaaactttttccagaacaaacctaatgattag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741346
Entry
103741346         CDS       T03372                                 

Gene name
Ghr
Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103741346 (Ghr)
   04151 PI3K-Akt signaling pathway
    103741346 (Ghr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103741346 (Ghr)
   04060 Cytokine-cytokine receptor interaction
    103741346 (Ghr)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    103741346 (Ghr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103741346 (Ghr)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  Prolactin receptor family
   103741346 (Ghr)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 DUF4605
Other DBs
NCBI-GeneID: 103741346
NCBI-ProteinID: XP_008840326
LinkDB
Position
Un
AA seq 637 aa
MDLWQLLLTLVLAGSSDAFSGSEVTPATLGKASRFLQIINPGLRTNSSGKPKFTKCRSPE
LETFSCYWTDGDYHDLKTPGSIQLFYARRIAHEWSQEWKECPDYVSAGENSCYFNSSYTS
IWIPYCIKLTKNGGMVDQKCFTVDEIVQPDPPVGLNWTLLNISVTGAHGDIQVRWDPPPS
ADVRKGWIILEYELQYKEVNETQWKMMDPMLATSVPLYSLRLDKEYEVRVRSRQRSFEKY
SEFSEVLYVTLPQVSAFTCTEDLQFPWFLIIIFGIFGLTLMLFVVIFSKQQRIKMLILPP
VPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKPEFYNDDSWVEFIELDIDDADEKTEGS
DTDRLLSSHHEKSLNILGAKDDDSGRTSCYDPDILDSDFHAGDMCDSSSEFAQLQSLKAE
ADLLCLDQKTQKNSPVDASPATQHASIALTEEDKPQPLISEAESIHQLASTQISNPSSLA
NIDFYAQVSDITPAGSVVLSPGQKIKAGIAQCNMHPEVVTPCQANYNMDSTYFCEADAKK
CIAVAPHMEVKSRVDPSFNQEDFYITTESLTTTAGRSETAEIAPSAEMPVPDYTSVHTVQ
SPEGLVLNATALPLPDKKGFLSSCGYVSTDQLNKIMQ
NT seq 1914 nt   +upstreamnt  +downstreamnt
atggatctttggcagctgctcttaaccttggtactggcaggctcaagtgatgcattttct
ggaagtgaggttacaccagctacccttggcaaagcatcccggtttctgcaaataattaat
ccaggcctgaggacaaattcttctgggaagcctaaattcaccaagtgccgttcacctgaa
ctagagacattttcttgctactggacggatggagattaccatgatttaaagaccccagga
tccatccagctgttctatgctagaaggatcgcccatgaatggtcccaagaatggaaagaa
tgccccgattatgtctctgctggagaaaacagctgttactttaactcatcgtatacctcc
atctggataccctattgcatcaagctaactaaaaatggtggtatggtggaccaaaagtgc
ttcactgttgatgaaatagtgcaacctgatccacccgttggcctcaactggactttactg
aacatcagtgtgaccggggctcatggagacatccaagtgagatgggatccaccacccagt
gcagatgttcggaagggatggataattctggagtacgaacttcagtacaaagaagtaaat
gaaactcaatggaaaatgatggaccctatgttggcaacatcagttccactgtactcgttg
agactagataaagaatatgaagtacgtgtgagatccagacagcgaagctttgaaaagtac
agcgagttcagtgaggtgctctatgtaacacttcctcaagtgagcgcattcacttgtaca
gaagatttacagtttccgtggttcttaattatcatctttgggatatttggactaactctg
atgctatttgtagttattttctcaaaacagcaaaggattaagatgctgattttgccccca
gtcccagttccaaagattaaaggaattgatccagatcttcttaaggaaggaaaattagag
gaggtgaacacaatcttagccattcatgataactacaaacctgaattctacaatgatgac
tcctgggttgaatttatcgagctagatattgatgatgctgatgaaaagactgaagggtca
gacacagacagacttctaagcagtcaccatgagaaatcacttaatatccttggagcaaag
gacgatgattctgggcgcaccagctgttatgaccctgacattctggacagtgatttccat
gctggtgatatgtgtgatagttcctcagagtttgctcagctgcaaagtttaaaagcagaa
gccgatctcttgtgccttgaccagaagactcaaaagaactcacctgttgatgcttcccct
gccactcagcatgccagcatcgccctaacggaggaagacaaaccacaaccacttattagt
gaagctgagtcaatccaccaacttgcttctacccagataagcaatccttcttcactagcg
aacatcgacttttatgcccaagtaagcgacataacaccagcaggaagtgttgtcctttct
ccaggccaaaagattaaggcaggaatagcccagtgcaacatgcatccggaggtggtcaca
ccctgccaagcaaattacaacatggacagcacctacttctgcgaggcagacgccaaaaag
tgcatcgcagtggcccctcatatggaagtcaagtcccgcgtagacccaagctttaaccag
gaagacttttacatcaccacagaaagccttaccactactgctggaaggtctgagacagca
gagattgctccaagcgcagagatgcctgtcccggactatacctccgttcacacagtgcag
tctccagagggccttgtactcaatgcgactgctttgcctttgcctgacaaaaaagggttc
ctctcatcgtgtggctacgtgagcacagaccaactgaacaaaatcatgcagtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741367
Entry
103741367         CDS       T03372                                 

Gene name
Osmr
Definition
(RefSeq) oncostatin M receptor
  KO
K05057  oncostatin M receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103741367 (Osmr)
   04151 PI3K-Akt signaling pathway
    103741367 (Osmr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103741367 (Osmr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103741367 (Osmr)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL6/12 receptor family
   103741367 (Osmr)
SSDB
Motif
Pfam: fn3 LIFR_D2 EpoR_lig-bind
Other DBs
NCBI-GeneID: 103741367
NCBI-ProteinID: XP_017655837
LinkDB
Position
Un
AA seq 971 aa
MAFSVVLQKAFLLALLSLRAYQNEVFDEPIQLVPEVQNVSTSSKPQQVNLQWTVPNLAHH
QELKMMLQIEISRIKTSNVIQVVNYTTTVKWNQVMHWNWKPDIPLECVKYFLRIRGMVDD
DKFLLQSSWSNWSSWQEAHIPVSLEPNTVLVFPEDPLVEEGSNITICSVYGRNQHNVSCY
LQEKPIPGEQLDSHVSIFNLNNVVFFRDTGTNFFCNSIDTKLEDGIVLFVSKVLEEPKNF
SCETQDFKTLNCIWEPGVDTALAWKQQPPQNYTLFESFSGRRKLCNKSSCDWQITDDSQE
IYNFTLIAKNYLRTRSVSVSFHLTHRVYLKAPHNVSLEIINTTKAHMTWKVHSRGNDYTL
LCQIELLCEKEVIHEHNVSVHMSGDYLFNDLDPDTEYKASVRCADATHFWKWSNWAEKTF
STPEAAPSEALDVWRIVRSKNGSRIVTLFWKPLSKSRANGKILFYNIVAENQDKPAKSKH
CSIPAPASDTQLTLDQSSYKLHITANNSVGMSPETILVLSRESGNQEVVEKRINGTKDGF
LISWEPRSRDVISYIVDWCAHSQNQLCDLQWKNLGPNTTSTIISSDAFKPGVRYNFRIFE
IPVQGPVYLVEKQTGYTQELAPLESPEVLTSNLTSHSFTLSWQGYASQFQAGFIQGYRVY
LKSKEMHCHSGWDKVLLSDNSVCCNYDIKDPKQKIFTVENLRPESDYEFSVRSYTSVGEN
QNATFMMVTTPDEHSHMLLKTMLPMSLCVLLIMVVCYWKSQWVKETCYPDIPNPSKSSIL
SPIKYMQNPHLTIMNVKDCIPDVLEVINKAEGTKTLYTGAGKLHAENVTKLPPVPTEKDS
CGPVPCIFFENFTYDQLAFDSDSHGHVPGPLKDILCQLGPLTPPKNLLNVLGNSNMKSLT
GSPTEETSLIYVSQLASPTCGDKDSLTTNLPRPVHCSEYKMQMAVPPSLASPALSKNSDL
SSMILLGKGEP
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggctttctctgtggtccttcagaaagcattcctcttagctttgctgtccttgagggct
taccaaaatgaagtctttgatgaacctatccagttggttcccgaggtacagaatgtttcc
acctcttctaaaccgcagcaagtgaatttacaatggactgtcccaaaccttgctcatcac
caggaattaaaaatgatgctccagatagagatcagtagaatcaaaacatccaatgtgata
caggtggtgaattacactaccactgtgaagtggaatcaagttatgcactggaactggaaa
cctgacatccctttggaatgtgtaaaatacttcttaagaataaggggcatggtggatgat
gataagttcctcctacagagttcctggagcaactggagttcctggcaggaagctcatata
ccagtttctcttgaacccaatacagtgctagtatttcctgaagatccactggtggaagaa
ggctccaacatcactatttgttctgtgtatggaaggaatcagcataatgtgtcttgttat
ttgcaagaaaaaccaatacctggagaacaacttgattcccatgtgtccatattcaatttg
aataatgttgttttctttagagacacagggacaaactttttttgtaacagcatagatacc
aaacttgaagatggtattgttctctttgtctcaaaagtacttgaagaacccaagaacttt
tcttgtgaaactcaagacttcaagactttaaactgtatatgggaacctggggtagatacg
gctttggcttggaaacaacaacctccccaaaactacactttatttgaatcgttctctgga
agaagaaaactctgtaacaaaagctcatgtgattggcaaatcactgatgattctcaggaa
atatataacttcacactcatagctaaaaattatttaaggacgagaagtgtcagcgtcagt
tttcacctgactcatcgagtttatctaaaagctccccacaatgtcagccttgaaattata
aataccacaaaagcccatatgacctggaaggtgcactcccgggggaatgactacacactt
ctgtgtcagattgaactcctatgtgaaaaagaagtgatacatgagcacaatgtttctgtc
cacatgagtggtgactacctcttcaatgatctggatcctgacacagagtacaaggccagt
gtgcgctgtgcagatgccacccacttctggaaatggagtaactgggctgaaaaaacattc
agcacacctgaagccgctccctcagaggcccttgatgtttggagaatagtgaggtcaaag
aatggaagtcgcattgtgaccttattctggaagccactatcaaaatcacgggccaatggc
aagatcctattctataatatagttgcagaaaaccaagacaaaccagctaagtcaaaacat
tgctccatcccagcaccggcctctgacacacaactgacacttgaccagtcttcttacaag
cttcacatcacggccaacaacagtgtaggcatgtcacctgaaacgatattggttctctct
agagaatctggaaaccaagaggttgttgagaaaagaattaatggcacaaaagatggattc
cttatttcttgggagcccaggtctagagatgtcataagttatattgtggattggtgtgct
cattcccagaaccagctctgtgatttacagtggaagaacctaggtcccaataccacaagt
accatcatcagttcagatgcttttaaaccaggggtccgttacaacttcagaatttttgaa
atacctgtgcaagggcctgtttatttagtagagaagcaaacaggatacactcaggaactg
gctcctttggagagcccagaagtgctcacgagtaacttgacctcacactccttcactctg
agctggcagggttatgccagccagttccaggctggttttatacaagggtaccgtgtctat
ttgaagtccaaggagatgcattgccactcaggatgggacaaggtgcttctttcagataat
tcagtgtgctgcaattatgacatcaaagacccaaagcaaaagatattcactgtggaaaac
ctgaggccagaatccgactatgagttctccgtgaggtcatacaccagtgttggtgagaac
cagaatgctaccttcatgatggtcacgactccagatgagcactcccacatgctgctgaag
acaatgttgcccatgagtctctgtgtcttgctcatcatggttgtgtgctactggaaaagt
cagtgggtgaaagagacatgctatcctgacatcccaaacccatccaagagcagcatcctg
tcaccaataaaatacatgcagaaccctcatttgacaattatgaacgtcaaagactgcatt
ccagatgttcttgaagttataaacaaggcagaaggcaccaagacactgtatacaggtgct
gggaagctacatgcagaaaacgtgactaaacttccccctgtgccaacagaaaaggattcc
tgcggccctgtgccctgcatcttttttgagaactttacttatgatcagttagcttttgat
tctgattcccatggccatgttccaggacctctaaaagacatactgtgccagctgggacca
ctgaccccacctaaaaatttactaaatgtactaggaaatagcaacatgaagtccctgact
ggcagtccaactgaagaaactagcttgatttatgtgtctcagctggcttcacccacgtgt
ggtgacaaggacagtctcaccacaaacctacccaggccagtgcactgttcagaatataag
atgcaaatggcagttcccccaagccttgcctcacctgccttgagtaagaacagtgacctg
tcctcaatgatccttttaggaaaaggtgaaccctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741561
Entry
103741561         CDS       T03372                                 

Gene name
Il11ra
Definition
(RefSeq) interleukin 11 receptor subunit alpha
  KO
K05056  interleukin 11 receptor alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103741561 (Il11ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103741561 (Il11ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103741561 (Il11ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103741561 (Il11ra)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL6/12 receptor family
   103741561 (Il11ra)
SSDB
Motif
Pfam: Ig_3 EpoR_lig-bind Ig_2 ig
Other DBs
NCBI-GeneID: 103741561
NCBI-ProteinID: XP_008840646
LinkDB
Position
Un
AA seq 421 aa
MSSSCSGLSRVLVAVATALVSSSSLCPQDWGPPGVQYGQLGRPVMLCCPGVTAGMLVSWF
RDGKSRLLQGPDSGLGQNLVLAQVDSADEGTYICQTMDGVLGGTVTLKLGFPPARPVVSC
QAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTMPGAESQRVSPSTGPWPCPQDPLGASRC
VVHGAEFWSEYRINVTEVNPLGTSTCLLDVRLQSILRPDPPQGLRVESVPGYPRRLRASW
TYPDSWRRQPHFLLKFRLQYRPAQHPAWSMVEPIGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSAWSPEAWGTPSTGPLQKEIPIWGLLHMQQQEAVAQEDGPTPPRPSLQSDPRPLDH
RDPLEQVAVLASLGIFFFLGLAAGALALGLWLRRGRKDEPQKPEFLASMIPVDKLSGAPN
L
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgagcagggtcctggtggccgtggctacagccctggtg
tcttcctcctccctctgcccccaagactggggtcccccaggagtccagtatgggcagctt
gggcggcccgtgatgctgtgctgccctggagtgactgctgggatgctggtgtcctggttt
cgggatggaaagtcaagactactacaaggacctgactctggactaggacaaaatctggtc
ctggctcaggtggacagtgctgatgagggcacttacatctgccagaccatggatggtgta
cttgggggcaccgtgacactgaagctgggctttcctccagcccgtcctgtggtttcctgc
caagcagttgactatgaaaacttctcctgtacttggagtcccgggcaggtcagcggttta
cccacccgctacctcacctcctacaggaagaagaccatgccaggagctgagagtcagagg
gtgagtccatccacagggccttggccatgcccacaggaccccctaggggcttcccgctgc
gtggtccatggggcagagttctggagcgagtaccggattaatgtgactgaggtgaaccca
ctgggtaccagcacatgcctgctggatgtgagattgcagagcatcttacgccctgaccca
ccccaaggactgcgagtagagtcagtacctgggtacccccgacgcctgcgagcaagctgg
acataccctgattcctggcgccgccagccccacttcctgctcaagttccgtctgcagtac
cgtccagcacagcatccagcctggtctatggtggagcccattggcttggaggaggtgatc
acagatgctgtggctgggctgccccatgccgtgcgagtcagtgccagagactttctggat
gctggcacctggagtgcctggagtccagaggcctggggcactcccagcactggtcctctg
cagaaagagatacctatttggggcctgctacacatgcaacagcaagaggcagtagctcag
gaggatggccccactcctccaaggccttccttacagtcagacccaaggccacttgatcac
agggaccccctggagcaagtggctgtgctggcatctttgggaatcttctttttccttgga
ctggctgctggggctctggcactggggctgtggctgagacggggtaggaaggatgaacct
caaaaacctgaattcttagcttcaatgattccagtggacaagctttcaggtgctccaaac
ctgtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741568
Entry
103741568         CDS       T03372                                 

Gene name
Cntfr
Definition
(RefSeq) ciliary neurotrophic factor receptor
  KO
K05059  ciliary neurotrophic factor receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103741568 (Cntfr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103741568 (Cntfr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103741568 (Cntfr)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ngi00537]
    103741568 (Cntfr)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL6/12 receptor family
   103741568 (Cntfr)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ngi00537]
 Receptors
  103741568 (Cntfr)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_5
Other DBs
NCBI-GeneID: 103741568
NCBI-ProteinID: XP_008840662
LinkDB
Position
Un
AA seq 372 aa
MAAPVPWACCAVLAAATAVVYTQKHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLHHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKMMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGELGSGGGPLVPFLISVPVTLAL
AAAAATASSLLI
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctgctcctgtcccatgggcctgctgtgctgtgcttgctgctgccactgctgttgtc
tacacccagaaacacagtccacaggaggcaccccatgtgcagtatgagcgcctgggctca
gatgtgacgctgccatgtgggacagcaaactgggatgcagctgtgacgtggcgggtgaat
gggacagatctggcccctgacctgctcaatggctctcaactggtactccatggcctggaa
ctgggccacagtggcctctatgcctgtttccaccgtgactcctggcacctgcaccaccaa
gtcctgctacatgtgggcttgccgccgcgggagcctgtgctcagttgccgctccaacact
taccccaagggcttctactgcagctggcatctgcccacccccacctacatccccaatacc
ttcaatgtgactgtgctgcatggctccaaaatgatggtctgtgagaaggacccagccctc
aagaatcgctgccatatccgctacatgcacctgttctctaccatcaagtacaaggtctcc
ataagtgtcagcaatgccctgggtcacaacgccacagctattaccttcgatgaattcacc
attgtgaaaccagatcctccagaaaatgtggtagcacggccagtgcccagcaaccctcgc
cggctagaggtgacatggcagaccccttcaacctggcccgaccctgagtcctttcctctc
aagttctttctgcggtaccggcctctcatcctggaccaatggcaacatgtggagctgtca
gatggcacagcgcacactatcacggatgcctatgctgggaaggagtacatcatccaggtg
gcagccaaggacaacgagattgggacatggagcgactggagtgtggctgctcatgccaca
ccctggactgaggaaccacgacatctcaccaccgaggcccaggcccccgagaccacgacc
agcaccaccagctccctggcacccccacccaccacgaagatctgtgaccctggagagcta
ggcagcggcggaggacccttggtacctttcttgatcagtgttcctgttactctggccctc
gctgccgctgccgccactgccagcagtcttctgatctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743079
Entry
103743079         CDS       T03372                                 

Gene name
Il13ra1
Definition
(RefSeq) interleukin 13 receptor subunit alpha 1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103743079 (Il13ra1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103743079 (Il13ra1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743079 (Il13ra1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103743079 (Il13ra1)
   04090 CD molecules [BR:ngi04090]
    103743079 (Il13ra1)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL3 receptor family
   103743079 (Il13ra1)
CD molecules [BR:ngi04090]
 Proteins
  103743079 (Il13ra1)
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind fn3 LIFR_N EpoR_lig-bind LIFR_D2
Other DBs
NCBI-GeneID: 103743079
NCBI-ProteinID: XP_008842507
LinkDB
Position
Un
AA seq 423 aa
MARPERLCGLWALLLCAAVERGAAATEIQPPVTNLSVSVENLCTIIWTWSPPEGASPNCT
LRYFSHFDDKQDKKIAPETHRSKEVPLNERICLQVGSQCSANESEKPSILVEKCISPPEG
DPESAVTDLQCIWHNLSYMKCSWLPGKNTSPDTHYTLYYWYSSLGKILQCENIYREGQHI
TCSFKLTKVDSSFEQHSVQIMVKDNAGKIRPSFKIVPLTSCVKPGPPHIKNLLFKNGALY
VQWKNPQNFSSRCLSYEVEVNISQSETHGIFYVEEDKCQNSESDRNAEGSTCFIVPGVPP
DTFYKVRVRVKTNKLCFDDNHLWSNWSQAECIGKEPNSTFYITMLLTIPVIVAGAIIVLL
LYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDISEKQSKEETDSVVLIENLKK
ASQ
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggcgcggccggagcggctatgcggactgtgggcgctgctgctgtgcgccgcggtggag
cggggagccgcggcaacagaaattcagccacctgtgacaaatttgagtgtctctgttgaa
aacctctgcacgataatatggacatggagtcctccagagggagccagtccaaactgtact
ctcaggtattttagccattttgatgacaaacaggataagaaaattgctccagaaacccat
cgttcaaaagaagtccccctaaatgagaggatctgtctgcaagtggggtcccagtgtagc
gccaatgaaagtgaaaagcctagcattttggtggagaagtgtatctcaccccctgaaggt
gatccagagtctgctgtgactgacctccaatgcatttggcataacctgagctacatgaag
tgctcctggctccctggaaagaatacaagccctgatacacactatactctttactattgg
tacagcagtctgggaaaaattctccagtgtgaaaacatctatagagaaggtcaacacatt
acttgttcctttaaactcactaaagtggattcgagttttgaacagcacagtgttcaaata
atggtcaaggataatgcaggaaaaattaggccatctttcaaaatagtgcctttaacttcc
tgtgtgaaacctggtcctccacatattaaaaatctcctcttcaaaaatggtgccttatat
gtgcaatggaagaatccacagaattttagtagtagatgtttatcttatgaagtggaagtc
aatatcagccagtctgagacacatggcattttctatgttgaagaggacaaatgccagaat
tcagaatctgacagaaatgcagagggttcaacttgtttcatagtccctggtgttcctcct
gatactttctacaaagtcagagtaagagtcaaaacaaataagttatgctttgatgataat
cacctctggagtaattggagtcaagcagagtgtataggcaaggagcccaactccacattc
tacataaccatgttactcaccattccagtcatcgttgcaggagcaatcatagtcctcctg
ctttacctgaagaggctgaagatcattatatttcctccaattcctgatcctggtaaaatc
tttaaagaaatgtttggagaccaaaatgatgacaccctgcactggaagaaatatgacatc
tccgagaagcaatccaaagaagaaacggattctgtagtgctgatagaaaacctgaagaaa
gcttctcagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743351
Entry
103743351         CDS       T03372                                 

Gene name
Il23r
Definition
(RefSeq) interleukin 23 receptor
  KO
K05065  interleukin 23 receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04659  Th17 cell differentiation
ngi05200  Pathways in cancer
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103743351 (Il23r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103743351 (Il23r)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103743351 (Il23r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743351 (Il23r)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103743351 (Il23r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103743351 (Il23r)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL6/12 receptor family
   103743351 (Il23r)
SSDB
Motif
Pfam: fn3 IL12p40_C IL6Ra-bind Lep_receptor_Ig Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 103743351
NCBI-ProteinID: XP_008842825
LinkDB
Position
Un
AA seq 627 aa
MSQLTFHLDVLIALYILCSWCHGGITTINCSGNIWVEPAPVLHMGTDVSIYCQAAVKNCQ
PKKLNFYKNGIKERFQITLINRTTAQLLYKNFLEPHASVYCTAQCPGHFQETLICGKDIS
SGYPPDAPDKVTCIIYEYSGHMTCTWNTGRLTYLDTKYVVHVKSLETEEEQQYLTSSYVN
ISTDSLQGGRKYLVWVQAVNALGMKESTKLQVHLDDIVIPSASIISSAKTVNATVAKTII
HWNSKSTIEKVSCEMRYKATASRTWNVEEFDTNLTHVQQSEFYLEPNIKYEFQVRCQETG
KRYWQPWSSPFVHKTPEAVPQVTPKSSPDAQNSGMRTTTIFKRHLASGNSQDIGFLSGMV
FLAIILPIFSLIGIFNRSLRIGIIRKILLLIPKWLHEDIPNMENSNVVKMLQEKNVFVNN
IVTEGALYVDPVITEISEIFLPAHKPADYKEEKSVGPLETRDCLQVSLSTSSVVYIPDLN
TGYKPQISSFHPGENHLNPSDETDSSTLELPGDLCGVGNNVKLKICPHFAFSVSSMNSLS
NTLALEELSLLLDKGECNPSDIQNSEKETTVFLENDSSRDTLPEQTLLPDEFVSCLAIGS
EELPSINSYFPQKVLESHFSGISLLQK
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgagtcagctcacatttcacttggatgtgttaatagccctttatatactctgcagctgg
tgtcatggaggaattacaactataaactgctctgggaacatctgggtagaacctgcccca
gttttgcacatgggcacggatgtctctatctactgccaagcagctgttaagaactgtcaa
ccaaagaaactgaatttttataaaaatggcatcaaagaaagatttcaaatcacattgatt
aatagaacaacagctcaacttttgtataagaactttctggagccacatgcctcagtgtat
tgcaccgctcagtgtcccgggcactttcaggagactctcatatgtggaaaagacatttct
tctggatatccaccagatgctcctgataaggtgacatgtatcatttatgaatactcaggc
cacatgacttgcacctggaacactgggagactcacctacctagacaccaagtacgtggtg
catgtgaagagtttagagacagaagaagagcagcaatatcttacctcaagctatgtcaac
atctctaccgattcactgcaaggcggtaggaagtatctggtctgggtccaagctgttaat
gcactaggcatgaaggagtcaacaaagttacaagtccatctggatgatatagtgatacct
tctgcatccatcatttccagtgctaagactgtaaatgctactgtggctaagaccataatt
cattggaatagcaaaagcacgatcgaaaaggtctcctgtgaaatgagatacaaagcaaca
gcaagccgaacttggaatgttgaagaatttgataccaatctcactcatgtgcaacagtca
gaattctacttggagccaaacatcaagtacgaatttcaagtgagatgtcaagaaacaggt
aaaaggtactggcagccctggagttcaccctttgtccacaaaacacctgaagcggttccc
caggtcacaccaaaatcatcccctgatgctcagaactctgggatgcggactactaccatc
tttaaaagacaccttgcttctggtaacagtcaagacatcggatttttgtcaggaatggtt
ttcctcgccatcatattgcctattttttctctgattgggatattcaacagatcgcttcga
atagggattataagaaaaatcttattgctaataccaaagtggcttcatgaagatattcct
aatatggaaaacagtaacgttgtgaaaatgctacaggaaaaaaatgtattcgtgaacaat
attgtcactgagggtgccctttatgttgatcccgtgattacagagatcagcgaaatcttt
ctgccagcacacaagcccgcagattataaggaagaaaagtccgtgggacccctggagaca
agagactgtctgcaagtatcattgtccaccagttctgttgtgtatattcctgatctcaac
acaggatacaaaccccagatttctagttttcaccctggggaaaaccacctcaaccccagt
gatgaaacagattcttcaacacttgaactaccaggtgacctctgtggtgtgggaaataat
gtcaagttaaaaatatgcccccattttgcattttctgtctcaagtatgaattcattaagc
aacaccctagctcttgaagaattaagtctccttttagataaaggcgaatgcaatccttct
gacatacaaaactcagaaaaagaaactactgtgtttctggaaaatgactcatccagggac
actcttccagaacagacactgctgcctgatgaatttgtctcctgtttggcgattgggagt
gaggagctgccatctattaattcttattttccacaaaaagttttggaaagccacttcagt
ggaatttcactcttgcaaaagtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743352
Entry
103743352         CDS       T03372                                 

Gene name
Il12rb2
Definition
(RefSeq) interleukin 12 receptor subunit beta 2
  KO
K05064  interleukin 12 receptor beta-2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi05200  Pathways in cancer
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103743352 (Il12rb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103743352 (Il12rb2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103743352 (Il12rb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743352 (Il12rb2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103743352 (Il12rb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103743352 (Il12rb2)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL6/12 receptor family
   103743352 (Il12rb2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig Tissue_fac IL6Ra-bind Pur_ac_phosph_N EpoR_lig-bind MdoG
Other DBs
NCBI-GeneID: 103743352
NCBI-ProteinID: XP_008842826
LinkDB
Position
Un
AA seq 855 aa
MAHAIRECSLALTFLTLWLLVKANIDVCKRGQVTAKPSHVVPLGSPVIISCSLKPRQGCL
YYSTLNKLILYKSGQEVSVHHGQSFSFQATDLPLGKTVFVCKLACIRSDESQVCGVEISV
GVVPEQPRSLSCIQKGEHGNVTCTWDPGRNTCLSTNYTFQLTGPKNTTWKNHCHNCDHLD
LGTSLKPELPESRFLAKVTGTNGLGSASSSPFPYTFLDIVRPLPPWDIRINFLNASVSRC
TLRWEDEERVMLNRLRYRPRNSEFWNMVNVTNAKGRHDLQDLRPFTEYEFQISSKLHLYK
GSWSDWSESVKIQTPEEEPTGTLDVWYMKQNIDSERQRLSLFWKNLSTSEARGNILYYQV
TLQEMTGRRTALQNSTERTSWTWVIPRTGTWAATVSAANSKGSSLPTRITIVHLCGTGLL
APHQISANSENMDNIVVAWQPPEKAASAVWEYVVEWRALHPGSFPQPPLSWLRIPPYNLS
AQISANIKPYTCYEIHVHALSESQGGCISILGDSKHKAPLSGPHISNITEEKGSLFISWN
HIPVQEQMGCILHYRIYWKERDSSSQPELCEIPYRSSQSSHPINSLQPGVTYVLWMTALT
AAGESPQGNEREFCLQGKANWKAFVASSICIAIITVGIFSVRYFRQKVFALFSTLRPQWC
GREIPDPANSTWAKKYSIVEKMLLPMDSLLMAWPAPEEPEPLIINEVFYQMIPVFRHPHC
PRWPEREQGVHHSSSKEDTVYTSSSSQPSRTLTVETRQLVDLYKVLGNRVPDSKLDNPIS
PLTAIPVDYLPSHEGYLPSNIDDLPPQENSPTDSLEPQHQHISLSVFVSSSLHPLTSCGE
RLTLDQLKMGCVTPS
NT seq 2568 nt   +upstreamnt  +downstreamnt
atggcacatgctattagagaatgctcactggcacttacatttttaaccctgtggctgttg
gttaaagcaaatatagatgtgtgcaagagaggacaagtgactgcaaagccttcccatgtg
gtgccgctgggatcacctgtcattatttcctgctctttgaaacccagacaaggctgtttg
tactattctactttgaacaaattaatcctctacaagtcgggccaagaagtcagtgtccac
catggtcagtccttcagttttcaagccacagatcttccccttggcaaaaccgtgtttgtc
tgcaagctggcctgtatccgtagcgatgagagtcaagtttgtggggtggagatctcagtt
ggtgttgttccagagcaacctcgaagcctgtcttgtatacagaagggagaacatgggaat
gtgacttgcacctgggacccaggaagaaacacttgcctaagcaccaactataccttccag
ttaactggaccaaaaaacacaacttggaagaatcactgtcacaactgtgatcatttggac
cttgggaccagcctaaaacctgaattacctgaatccaggttcttagccaaggtcactggc
accaatgggcttggaagcgcttcttcatctccatttccttacacattcttggacatagtg
aggcctcttcctccgtgggacatcaggatcaacttcctaaatgcttctgtcagcagatgt
acccttcggtgggaggatgaagagcgagtgatgcttaatcgcctcagataccggccccgt
aacagcgagttctggaacatggttaatgtcacaaatgccaaaggaagacatgatttgcag
gatctgcgaccatttacagagtatgaatttcagatttcctctaaactacatctttataaa
ggaagctggagtgattggagtgaatcagtgaaaatacaaacaccagaggaagagcctact
gggacattagatgtctggtacatgaaacagaacatcgactctgagagacaacggctatcc
cttttctggaagaatctgagcacatcagaagcacgggggaacatcctctactatcaggtg
accttgcaggagatgacagggaggagaaccgcactgcagaacagcacagaacgcacctcg
tggacctgggtcattcccagaaccgggacttgggctgcaactgtgtctgcagccaactca
aaaggcagttccttgcccactcgaattaccatagtgcacctgtgtggcactgggttgctg
gctcctcaccagatctctgcaaactcagagaacatggacaacatcgtggtggcctggcag
cctccagagaaagctgcctctgcagtttgggagtatgtggtagaatggagagccctccat
ccagggagcttcccacaacctccactaagctggcttcgaatccccccctacaacttgtct
gctcagatttcagcaaacataaagccctacacctgttatgaaatccatgtacatgcactg
tcagaaagtcaaggagggtgtatctccatcctgggtgactccaagcacaaagcaccactg
agtggccctcacatcagtaacattacagaggaaaaggggagcctttttatttcctggaac
cacatcccagtccaggagcaaatgggctgcatcctccattacagaatatactggaaagaa
cgagactctagctcacagcctgaactctgtgaaattccctacagaagctcccaaagttca
cacccaataaacagcctgcagcctggagtgacatatgttctgtggatgacagctctgact
gctgctggtgaaagccctcaaggaaacgaaagggaattttgtctacaaggaaaagccaac
tggaaagcatttgtggcatcaagcatttgcatcgctatcatcacagtgggcattttctca
gtacgttactttcggcaaaaggtatttgctctcttttctactctcagacctcaatggtgt
ggcagagaaattccagacccagcaaacagcacttgggcaaagaagtactccattgtggag
aagatgctgctgcctatggacagtctcttgatggcctggcccgctcctgaagagcctgag
cccctgatcatcaatgaggtcttttaccaaatgatcccagtcttcagacacccccactgc
cccagatggccagaaagagaacaaggagtccatcactcttcctccaaggaagacacagta
tacacctcctccagctcacaaccttcaagaaccctcacagttgagacaagacaactagtg
gatttatacaaggtgctagggaatagggtccctgactcaaaactggacaatccaatcagc
cccttaacagccattccagtggactaccttcccagccatgaaggctatttaccctccaac
atagatgacctcccgccacaagagaattctccaacagattctttagaaccacagcatcag
cacatctctctttctgtttttgtgtcaagttcccttcacccactcacctcctgtggtgag
aggctgactctggatcagttaaagatggggtgtgtgactccctcgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743852
Entry
103743852         CDS       T03372                                 

Gene name
Mpl
Definition
(RefSeq) MPL proto-oncogene, thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103743852 (Mpl)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103743852 (Mpl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103743852 (Mpl)
   04090 CD molecules [BR:ngi04090]
    103743852 (Mpl)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  Prolactin receptor family
   103743852 (Mpl)
CD molecules [BR:ngi04090]
 Proteins
  103743852 (Mpl)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind LIFR_N
Other DBs
NCBI-GeneID: 103743852
NCBI-ProteinID: XP_008843567
LinkDB
Position
Un
AA seq 634 aa
MPSWALFMATSCLLLAPPNLAQVSSQDAFLLASDSEPLNCFSQTFEDLTCFWDEEKVAPN
GTYQLLYAYPGEKPRACPLSSQSSLFGTRYVCRFPAQDEVRLFFPLHLWVKNVFLNQTVT
QRVLFVDSVGLPAPPSIIKAGGGSQPGELQIHWKAPAPEISDFLRHEVRYGPMDSSNSTG
PSVMQLLSTETCCPTLRMLNPVPVLDQPPCIQPTVPQQQGPMRTAPTGEVPSPTVRGGSC
LISGFRPGKSYWLQLRSQPDGVSLRGSWGPWSFPVTVDLPGDAEAIGLQCFTVDLKNVIC
QWQQQAHASSQGFFHHSRTRCCPRDGDPTWEKCEDEETNPGSQPPQFSRCHFKSQNDSVI
HILVEVTTAQGDVHSYLGSPFWIHQAVLLPTPSLHWREVSSGQLELKWQHPSSWAAQETC
YQLRYTGEGHQDWKVLEPPLGAGGGTLELRPRSRYSLQLRARLNGPTFQGPWSAWSQPAR
VETATETAWISLVTALLLVLSLSALLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVIGQY
LRDTATLSPPKATVTDTCEEVEPSLLEILPKSSERTPLPLCSSQPRTDYRGLQPSCLGPV
PLSVCPPPVAEAGSCCTTHIANHSYLPLSYWQQP
NT seq 1905 nt   +upstreamnt  +downstreamnt
atgccctcttgggccctcttcatggctacctcctgtctcctcctggctcctccaaacctg
gcacaagtcagcagccaagatgccttcttgctggcctcggactcagagcccctgaactgt
ttctcccaaacatttgaagacctcacttgcttctgggatgaggaaaaggtagcacccaat
gggacataccagctgttgtatgcctatccaggagagaagccccgagcctgccccctgagt
tcccagagttccctctttggaacccgatacgtgtgccggtttccagcccaggatgaagta
cgcctcttctttccgctgcacctctgggtgaagaatgtgttcctgaaccagactgtgacc
cagcgggtactcttcgtggatagtgtaggcctgccagctccccccagtatcatcaaggct
gggggcgggagccagccaggggaacttcagatccactggaaggcccccgctcctgaaatc
agtgatttcctgagacatgaagtccgctatggccccatggactcaagcaactccactggc
ccctcagtcatgcagctgctctccacagaaacctgctgtcccactctgcggatgctgaac
ccagtccctgttctggaccagcctccatgcattcagcctacagtaccccaacaacaagga
ccaatgaggaccgccccaactggagaagttccatctccgacagtaagaggtggaagttgt
ctcatctcggggttccggcctggcaagtcctactggctccagctgcgcagccaacctgat
ggagtctcccttcgtggatcctggggaccctggtccttcccggtgactgtggacctgcca
ggagatgcagaggcaattggactgcagtgctttaccgtagacctaaagaatgttatctgt
cagtggcagcaacaagcacatgctagttcccagggcttcttccaccacagcaggacacgg
tgctgccccagagatggggaccccacctgggagaagtgtgaagatgaggaaacaaatcca
ggatcacagccccctcagttctcccgctgccacttcaagtcacaaaatgacagtgttatt
cacatccttgtagaggtgaccacagcccaaggtgatgttcacagctacctgggctctcct
ttctggatccaccaggctgtgctcctccccaccccaagcctgcactggagggaggtgtca
agtgggcagctagaattgaagtggcagcacccttcatcctgggcagcccaagagacctgc
tatcagctccgatacacaggagaaggccatcaggactggaaggtgctggaaccgcctctc
ggggccgggggagggaccctggagctgcgccccagatcccgctacagcctacagctgcgc
gccaggctcaacggccccactttccaaggcccctggagcgcctggtctcagcccgcgagg
gtggagaccgccacggagaccgcctggatctccttggtgactgctctgctcctggtgctg
agcctcagtgctcttctgggcctgctgctgctgaggtggcagtttcctgcccattacagg
aggctgaggcatgccttgtggccgtcacttccagacctacaccgggtcataggccagtac
cttagagatactgcaaccctaagtcctcccaaggccacagttactgacacctgcgaagaa
gtggaacccagcctccttgaaatcctacctaagtcctcagagaggactcccttgcccctg
tgttcttcccagcctcggacggactaccgaggactgcagccttcttgcttggggcccgtg
cccttgtctgtgtgcccaccccctgtggctgaggcagggtcctgctgtactacccacatc
gccaaccactcctacctaccgctaagctattggcagcagccctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746427
Entry
103746427         CDS       T03372                                 

Gene name
Il22ra1
Definition
(RefSeq) interleukin 22 receptor subunit alpha 1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103746427 (Il22ra1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103746427 (Il22ra1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103746427 (Il22ra1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103746427 (Il22ra1)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL10/28 receptor family
   103746427 (Il22ra1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 103746427
NCBI-ProteinID: XP_008846834
LinkDB
Position
Un
AA seq 573 aa
MKTLLTIVAVGFLAAHFAEDTSSLQYVKFQSSNFENILTWDDGPESIPGTVYSVEYKRYG
ETEWLAKEGCQRTTQKSCNLTMETSNLTELYYAMVTAFSPGSLLDSKRSDRFSSLQHTTI
KPPDVTCIPKVRSIQMLVHPTFTPILAEDGHQLALEEIFHDLFYRSELRVNHTYQMYLEG
KQREYEFVGLTPDTEFLGSIKILAPMWSKESAPYVCRVKTLPDRTWAYSFSGAILFSMGF
LIGLLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLCFIQEHVLIPTLDLNSPSSRVQYSQV
MVSGPREPPRAAQRCNLPEISYVEQPDVSTLRPTNVPPQQTLSPPSYAPKSAPDVDVLPP
SYAPQVTSDAKVLFCTPQQVAKAQPSSYAPQAILDSWSASYAVCMEDSGKDSAPGTLSSP
KHLRPKCQLQKETLAGSCLPGDLSLQGVTSLAEEETSRAKSLPPPLELCTDRGPDVHSLH
SEEPGTPQYLKGTLSLLSSVQIEGHPVSLPLHTHSPSDQGPSPWGLLDSLVCLKDEGQVT
EAMSRDAGASELEQATELDSLFKGLALTVQWES
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgaagacgctactgaccatcgtggctgtgggattcctggctgcccacttcgctgaggat
acatccagtcttcaatacgtgaaattccagtccagcaactttgaaaacatcttgacgtgg
gacgacgggccagagagcatcccaggcacggtctacagcgtggagtataagaggtatgga
gagacggagtggctggccaaggagggctgccagcggaccacccagaagtcttgcaacctg
accatggagacgagcaatctcaccgagctctactatgccatggtcacagccttcagccca
ggaagcctactagacagcaagcggtccgatcgcttcagctcactgcaacacactaccatc
aaaccacctgatgtgacctgtattcccaaagtgaggtccattcagatgctggtccacccc
acattcacacctattcttgcagaagatggccaccagctagctctggaggagatcttccat
gacttattctaccgctcagaactccgtgtcaaccacacctatcaaatgtaccttgaaggc
aagcagagggaatatgagtttgttggactgacccctgacacagagttcctcgggtccatc
aagattttggctccaatgtggtccaaggagagtgccccctacgtgtgccgagtgaagacg
ctgcccgaccggacatgggcctactccttctcgggtgccatactgttctccatgggtttc
ctcatcggtttgctctgctacctgagctacagatatgtgaccaagccacctgcacctcca
aactccctgaatgtccagcgagtactgaccttccagcctttatgcttcatccaggagcac
gtgcttatccctaccttggacctcaacagccccagcagtcgggtacagtactcccaggtc
atggtctctggacctagagagccacctagagctgcacagcggtgcaacctgcctgagatc
agctacgtagagcaaccagatgtctctaccctccggcccaccaatgtgccaccacaacag
acactgtctccaccatcctatgccccaaagtctgcccctgatgtcgatgtcctaccccca
tcctatgcacctcaggtaacctcagatgccaaagttctgttctgtactccacagcaggtg
gcaaaggcccagccttcctcctatgccccacaggccattctggacagctggtctgcttcc
tatgctgtgtgcatggaagattctggcaaagactctgctcctgggaccctctccagtccc
aaacacctcaggccaaaatgtcagctccagaaagagacactggctggaagctgtctccca
ggggacctttctctgcaaggtgtcacctccttggctgaggaagagacatccagagcaaaa
tcactgcccccacctctggaactttgcacagacagaggacctgatgtgcattcactccac
agtgaggagccagggacaccacagtacctgaaggggacactctccctcctgtcctctgtc
cagattgaaggtcaccctgtctccctccctttgcacactcattccccctcagaccaggga
ccaagcccctggggactgttggactctctcgtgtgtctcaaagatgagggacaagtgacc
gaggccatgagtcgggatgctggggcctctgagctggagcaggccaccgagctggattct
cttttcaaaggcctggccctgactgtgcaatgggaatcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746428
Entry
103746428         CDS       T03372                                 

Gene name
Ifnlr1
Definition
(RefSeq) interferon lambda receptor 1
  KO
K05140  interferon lambda receptor 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103746428 (Ifnlr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103746428 (Ifnlr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103746428 (Ifnlr1)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL10/28 receptor family
   103746428 (Ifnlr1)
SSDB
Motif
Pfam: Tissue_fac SCF
Other DBs
NCBI-GeneID: 103746428
NCBI-ProteinID: XP_008846835
LinkDB
Position
Un
AA seq 533 aa
MWQAGGWAPLLLCLMLSAPGRPRLVPPQNVMLLSQNFTVYLTWLPGFGSPRNVTYFVSYQ
GTPNPRRWRKVEQCAGTRTLMCPMMCLKKQDLYNKFKGRVQAASAGVRSDHVESNYLEYL
FEVEPAPPTLMLTRTKSILKVNATYQLPPCIPSLDLKYEVEFWKESTGSKILFPATPHGQ
PIQIPLQPGASGRHCLSARTIYTFIALKYSHFSEPSCIFLETPGASWAFLVLPSLLPLLL
AAATGGVIWKKIERNPWFQQVKRSRALDFSGYRDPLAYFQPSEPESPDELFLCPQKELTI
RIRPGSRVRGPGTLQAGSEKNSTGDEDEDTDDSDSFQPYLERPLFLRKELQVTGRSEADE
SGVDSGRSWTPPIGSEGSSAWDPSDRSWPSTVDSSLGSMARSSSYLDKELDQGLGRDGHQ
EALPHLEFSEELGSSEELPKDDLSHWATWASSSLKQDLVPGELPVSLHTLTLCWHSNSEE
EEEEEEEEEEEEAENEEGHWGSELKDSSASCWGAVSLQRTEVRGEMLGHYMAR
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgtggcaggcgggcgggtgggcgcccctgctcctgtgcctgatgctcagcgccccagga
agaccccgtctagtcccaccccagaacgtgatgctgctctctcagaactttaccgtgtac
ctgacgtggctcccagggtttggcagtccccggaacgtgacctatttcgtgtcctatcaa
ggcactcctaacccccgacgttggcgaaaagtggagcagtgtgcaggaaccaggactctg
atgtgtcccatgatgtgcctgaagaaacaggacctgtacaacaaattcaaagggcgtgtg
caggctgcttctgcaggtgtcaggtctgaccatgtagagtccaactacctagagtacctt
tttgaagtggagccagccccgcctaccctcatgctcaccagaaccaagagcatcctgaag
gttaatgccacctaccagctgcccccttgtataccctcactggacctgaagtacgaggtg
gaattctggaaagagagcactggaagcaagatcctctttcctgccactccacacggccag
ccaatacagatcccactccagccaggtgccagcggacgccactgcctcagcgccagaacc
atctataccttcattgccctcaagtacagccacttctctgagcccagctgcattttcctg
gaaaccccaggggccagctgggctttcctggtgctaccctcactcctgcctctgctgttg
gcagctgccacagggggtgtgatctggaagaagattgagagaaacccctggtttcagcag
gtgaagaggtctcgagcactggacttctctgggtacagagacccattggcatactttcaa
cctagtgaaccagagtctccagatgagctattcctctgtccccaaaaggaactgaccata
aggatcaggccaggctctcgagtcaggggcccaggcaccttacaggcaggatcagaaaag
aacagcactggggatgaagatgaagacacagatgacagtgacagcttccagccctacctg
gaacggcctctcttcctgagaaaggagctccaggttacgggacgttctgaggcagatgaa
tctggagtggattcagggaggtcctggacacctccaattgggagtgaaggctcttctgcc
tgggacccttcagacaggagctggcccagcactgtggactcctcacttggcagtatggct
aggtcctccagctatttggacaaggagttggaccaagggcttggtagagatgggcatcag
gaggctctcccacacctggaattctctgaggagttgggctcctcagaagagcttccgaag
gatgacctctcccattgggccacttgggcttcctcatccctgaagcaagatctggtccct
ggggaactcccagtttctcttcacacactaactctctgctggcacagtaactctgaggag
gaagaagaagaggaggaagaagaggaggaagaagaggcagagaatgaagaaggtcattgg
ggatcagaactcaaggacagcagtgccagctgctggggggctgtgagtctgcagaggaca
gaggttaggggtgagatgctaggacattacatggccaggtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747076
Entry
103747076         CDS       T03372                                 

Gene name
Pdgfrb
Definition
(RefSeq) platelet derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04630  JAK-STAT signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103747076 (Pdgfrb)
   04014 Ras signaling pathway
    103747076 (Pdgfrb)
   04015 Rap1 signaling pathway
    103747076 (Pdgfrb)
   04630 JAK-STAT signaling pathway
    103747076 (Pdgfrb)
   04020 Calcium signaling pathway
    103747076 (Pdgfrb)
   04072 Phospholipase D signaling pathway
    103747076 (Pdgfrb)
   04151 PI3K-Akt signaling pathway
    103747076 (Pdgfrb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103747076 (Pdgfrb)
   04540 Gap junction
    103747076 (Pdgfrb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103747076 (Pdgfrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747076 (Pdgfrb)
   05206 MicroRNAs in cancer
    103747076 (Pdgfrb)
   05230 Central carbon metabolism in cancer
    103747076 (Pdgfrb)
   05231 Choline metabolism in cancer
    103747076 (Pdgfrb)
  09162 Cancer: specific types
   05214 Glioma
    103747076 (Pdgfrb)
   05218 Melanoma
    103747076 (Pdgfrb)
   05215 Prostate cancer
    103747076 (Pdgfrb)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103747076 (Pdgfrb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103747076 (Pdgfrb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103747076 (Pdgfrb)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ngi04090]
    103747076 (Pdgfrb)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103747076 (Pdgfrb)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103747076 (Pdgfrb)
CD molecules [BR:ngi04090]
 Proteins
  103747076 (Pdgfrb)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C2-set_2 TCAD9
Other DBs
NCBI-GeneID: 103747076
NCBI-ProteinID: XP_008847605
LinkDB
Position
Un
AA seq 1109 aa
MGIMGLPGVMPALILKGQLQLLPLLWLLGPQSSQTLVITPPGPQLVLNISSTFVLTCSGS
APVMWEQMSQVPSQKVAMTQDGNFSSMLTLTNVTGGDTGEYFCAYNNSLGPELSERKRIY
IFVPDPTMGFLPVDPEELFVFVTEVTETIIPCRVTDPHLEVTLHEKKVDIPLHVPYDHQR
GFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVKTVVRQGETITIMCIV
TGNDVVNFKWTYPRMESGRLVEPVTDYLFEMPSRIGSILRIPNAELNDSGIYTCNVSVSA
NDHGDEKSINITVVESGYVRLLRTLGPVQIAKLHRSRTLQVVFEAYPPPTVLWFKDNHTL
SDSSAGEMALSTRNVSETRYVSELTLVRVKVAEAGYYTMRVFHEDAEAQLSFKLQVNVPV
RVLELSESHPANGEQTIRCRGQGMPQPNVTWSTCRDLKRCPRKLSLPLLGNSSEEESQLE
TNVTFWEEEQVYEVVSMLRLRHVDQPLSVRCMLQNSEGKDVQEVTVVPHSLPFKVVVISA
ILALVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDPTWELPR
DQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSH
LGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSDKPRPLSAELYS
NALPVGLSLPSHLSLTGESDGGYMDMSKDESVDYVPMLDMKGDIKYADIESSNYMAPYDN
YVPSAPERTYRSTLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEG
KLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIF
TLGGTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLL
LERLLSEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEG
DNDYIIPLPDPKPDTAEEGPLESSPSLASSTLNEVNTSSTISCDSPLDPQEESEQDSQPE
PQTEPEAELEQPQDSKCPGSLAEAEDSFL
NT seq 3330 nt   +upstreamnt  +downstreamnt
atgggcatcatggggcttccaggtgtgatgccagctttgatcctcaaaggccagttgcag
ttgctgcctctgctatggctgctgggaccacagtcctcccagaccctggtcatcacaccc
ccagggccacagcttgtcctcaacatctccagcacttttgttctgacctgctcgggttca
gctccagtgatgtgggaacagatgtcccaggtaccctctcagaaagtggccatgacccag
gatggcaacttctccagcatgctgacactgactaatgttactgggggagacactggagaa
tacttctgtgcctataacaactccctaggaccagagctcagtgagcggaaacgtatctac
atcttcgtgccagatcccaccatgggcttccttcctgtggaccctgaggaattgttcgtc
tttgtcacggaagtaactgagacaataattccatgccgagtgacagacccccacctggag
gtgacactgcatgagaaaaaagtagacatccctctacatgtcccctatgaccaccagcga
ggtttcactggcacctttgaggacaagacttacatctgcaaaaccaccatcggggacagg
gaagtggactccgatacctactatgtctacagcctccaggtgtcatccatcaatgtctct
gtgaatgcagtgaagactgttgtccgccagggtgagacaattaccatcatgtgcatcgtg
actgggaatgatgtggtcaacttcaagtggacataccctcgcatggagagtgggaggctg
gtggagccagtgacagactacttatttgaaatgccctctcgcattggctccatcctgcgt
atccccaatgctgagctgaatgactctgggatctacacttgcaatgtgtcagtgagtgca
aatgaccatggagatgaaaagtccatcaacatcactgtggtcgagagtggctacgtgcgg
ctgctgagaacgctgggtcctgtacaaattgctaagctgcaccggagccggacactgcag
gtggtgttcgaggcttacccgccgcccactgtactgtggtttaaagacaaccacaccttg
agtgactccagcgccggcgagatggccctgtccacgcgcaacgtatctgaaactcgatat
gtgtcagaactgaccctggtgcgggtgaaggtggcagaggctggctactacaccatgagg
gtctttcatgaggatgctgaggcccagctctccttcaagctgcaggtcaatgtccctgtc
cgtgtgctagagctgagtgagagtcaccctgccaatggggagcagacaatccgctgtcgt
gggcagggcatgccccaaccaaatgtcacctggtctacatgcagagatctcaaaaggtgt
ccacgaaagctgtcactcccactcctggggaacagttcggaggaggagagccaactggag
actaatgtgactttctgggaagaagaacaggtatacgaggtggtgagcatgcttcgcctg
cgccacgtggaccaaccactgtcagtacgctgtatgctgcagaactcggagggcaaagat
gtgcaagaggtcactgtggtgccacactccctacccttcaaggtggtagtgatctctgcc
attttggccttggtggtcctcaccatcatctccctcatcatcctcattatgctgtggcag
aagaagccacgatatgagatccgatggaaagtgatcgagtctgtgagctctgatggtcac
gagtacatctacgtggaccctgtgcagctaccttatgaccccacatgggagcttccacgg
gaccagcttgtgcttggacgcactctcggttctggggccttcgggcaagtggtggaggcc
acggctcatggtctgagccattcacaggccactatgaaagtggctgtcaagatgctgaaa
tccacagcccgcagcagcgagaagcaagccctcatgtccgagctgaaaatcatgagtcac
ctcgggccccacctgaacgtggtcaacttgctgggggcttgcaccaaaggaggacccatc
tacatcatcacagagtactgccgctatggtgacctggtggactacctgcaccgcaacaag
cacaccttcttgcagcgccactctgacaagccccgcccactcagtgctgagctgtacagc
aatgcgctgccagtggggctctccctgcccagccacttgtccctgactggggagagtgat
ggtggttacatggacatgagcaaggatgagtctgtggactatgtgcctatgctggacatg
aaaggagacataaaatacgcagacatcgagtcctccaactacatggccccttatgataac
tatgtcccatctgcccctgagagaacctatcggtccaccctgatcaacgagtcaccagtg
cttagctacacagacctcgtgggcttcagctaccaggtggccaatggcatggagttcttg
gcctctaagaattgtgttcaccgagacctggcggccaggaatgtgctcatctgtgagggc
aagctggtcaagatctgtgactttggcctggctcgagacatcatgcgtgactcgaactac
atctccaaaggcagcaccttcctgcctctgaagtggatggcccctgagagcatcttcaac
agcctctacaccaccctgagtgacgtgtggtcctttgggatcctactctgggagatcttc
acactgggtggtactccttacccagagctgcccatgaacgagcagttctacaatgccatc
aagcggggctaccgcatggcccagcctgcccatgcctctgacgagatctatgagatcatg
cagaagtgctgggaagagaagtttgagattcggccccccttctcccagctggtgctactt
ctggagaggctgctgagcgagggttacaaaaagaagtaccagcaagtagatgaggagttt
ctgaggagtgaccacccagccatcctacgctcccaagccagattacctggattccatggc
cttcgatcccctctggacaccagctctgttctctacactgctgtgcagcccaatgagggt
gacaacgactacatcatccccttgcctgaccccaagccagacactgctgaggagggcccc
ctggagagttcccctagcctggccagctccaccttgaatgaagtcaacacttcctcaacc
atctcctgtgacagccccctggacccccaagaagagtcagagcaggattcccagccggag
ccccaaacagagcctgaggcagagctggagcagccacaagattctaaatgccctggatct
ctggctgaagcagaggacagcttcctgtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748240
Entry
103748240         CDS       T03372                                 

Gene name
Il9r
Definition
(RefSeq) interleukin-9 receptor
  KO
K05073  interleukin 9 receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103748240 (Il9r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103748240 (Il9r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103748240 (Il9r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103748240 (Il9r)
   04090 CD molecules [BR:ngi04090]
    103748240 (Il9r)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL2 receptor family
   103748240 (Il9r)
CD molecules [BR:ngi04090]
 Proteins
  103748240 (Il9r)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 103748240
NCBI-ProteinID: XP_008849046
LinkDB
Position
Un
AA seq 515 aa
MGEIETGFQLNNASVAEEAVCTRDSGLEPPGEACRASTATARDACGQTCQRLAWFCGQEP
RILRNSWTLEREALKQALGIWLLIYTCVCPCVCWGCSVPEQGGGLKAGTFTCLSNSILRI
DCHWSGPELAEDSRAWLLFTSNQVTGIRHKCMFWGNTCTLVLPPEEVLLQSDNFTITFHR
YILGQEQVSLVDSQYMPWRYVKLDPPSDLQSNVSSEHCVLTWSISPFLEPMIPHLNYELA
FKRQKETWEQARHKDHIVGVTWLKLEAIELNPGSTYEARLRVHMALLEDDMADKECFKGQ
WSEWSQSVLFSSPQKGLLIPPSGWSDSTLVTVSIFLLLSGLTHFLFKLSPRVKRIFYQNV
PSPAAFFHPLYSVHNGDFQTWIGAHRTGLQPTQDGVNTPPGGSESSIWEAITVLTYSPAC
PWQFSSLEEEGTGSSFLGHPSSEHVLPAGCVEFEGQPSAYLPQEDWAPVCPTRPAPQDSE
GSSSSGYCILHFPENTQGLEPLKPEPVAFPVSSRA
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgggtgaaatagagacgggatttcagctgaacaatgcctcagtagcagaggaagctgtc
tgcaccagagactcaggactcgagccgccgggagaagcctgcagggcatccacagccacg
gccagagacgcctgtggccagacctgccagcgactagcatggttctgtggccaggaacct
cgcatcctgaggaatagttggaccttggaaagggaggcactgaaacaggccctgggcatc
tggctcctgatctacacctgtgtctgcccctgtgtctgctgggggtgctctgtcccagag
cagggaggaggtttgaaggctgggacattcacctgcctcagcaacagtattctcaggatt
gactgccactggtctggtccagagttggccgaggactccagggcctggctcctcttcacc
agtaaccaggtgactggcatcaggcacaagtgcatgttttggggcaatacatgcaccctg
gtgctgccccctgaggaagtgctgctgcagagtgataacttcaccatcactttccaccgc
tacatcttggggcaggagcaagtcagcctggtggactcacagtacatgccgtggagatat
gttaagctggaccctccttctgacttgcagagcaatgtcagctctgaacattgtgtcctg
acctggagcatcagtccttttctggagcccatgatcccgcatcttaactatgagttggcc
tttaagagacagaaagagacctgggagcaggcccggcacaaggaccatattgttggagtg
acctggctcaagcttgaagccatcgagttgaatcctggttctacctacgaggccagactg
cgtgttcacatggctctgctggaggatgacatggcagacaaggaatgttttaagggccag
tggagtgagtggagccaatctgtgctcttttcctctccccagaagggcctcctgatccca
ccctcagggtggtcagacagcacccttgttactgtgtccatcttccttctgctaagtggc
ctgacccactttctattcaagctatcacccagggtgaagagaatcttctatcagaatgtt
ccctccccagcagccttcttccatcccctctacagtgtgcacaatggggacttccagacc
tggataggggcacacagaactggactacaaccaacccaggatggtgtcaacactccacca
ggaggctcagagtccagcatctgggaggccatcacagtgctcacctacagcccagcatgc
ccctggcaattctccagcctggaggaggagggtacaggctccagtttcctaggacaccca
agctcagagcatgtgctgccagctgggtgtgtggagtttgagggacaaccatctgcctac
ctgccgcaggaggactgggcccctgtgtgccccaccaggccagctccacaagactccgag
ggcagcagcagcagtggctactgtattttgcatttcccagaaaatacccagggccttgag
cccctgaagcctgagcctgtggcttttcctgtgtccagtagggcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748335
Entry
103748335         CDS       T03372                                 

Gene name
Il10ra
Definition
(RefSeq) interleukin 10 receptor subunit alpha
  KO
K05134  interleukin 10 receptor alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04630  JAK-STAT signaling pathway
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103748335 (Il10ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103748335 (Il10ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103748335 (Il10ra)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103748335 (Il10ra)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103748335 (Il10ra)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103748335 (Il10ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103748335 (Il10ra)
   04090 CD molecules [BR:ngi04090]
    103748335 (Il10ra)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL10/28 receptor family
   103748335 (Il10ra)
CD molecules [BR:ngi04090]
 Proteins
  103748335 (Il10ra)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 103748335
NCBI-ProteinID: XP_008849178
LinkDB
Position
Un
AA seq 577 aa
MLSRRLLLLSALVSLCLGFGAHGTELPSPPSVWFKAKFFQHILHWVPIPNPSENTSYEVA
LMRYGSRLWKTIPSCSQALELSCDLTNFTLDLYHSNGYRAKVRAIDGSQHSNWTLTKTRF
TLDEVTLTVDGVTLEALNGYIFGTIHLPGSQVAPEGNTYQDIFEYFRTYTIAFRKVPERT
FKIKMVNRENFSLSFPGEVGEFCVKVMPNVESRANKAEWSEEQCLHLTKQYFTVTNLSII
FTSILLFSGALVCLALQLYVRRRGKLPAVLIFEKTSPFFLVNFPCPDTYNTIHILDLVTF
QKVSPELKDSDLHGSTDSGFGSGKPSLQTEKPQFLLPGPHPQTQEALGKGEPPELQDSHS
DGSSDSTDSGICLQEPSLHPSTRPTWEQQVVGTSQGQDDSGIGLVPNSEGQPEHTKSGSH
LGHVSLLGPAVPEEEAPAVVAVQGYLKQTRYTEDMTNPTGCLEEEVSLIDAFDPKLRTCL
QAESDWPSLALAKGYLKQDTPGMTLVPTGTPGEHWNQLPEEWPLLVLPSCEDPNTVSWSF
AHDPAPLDCVAAPGGLLGSFDSNLVALPLISSLHTED
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgctgtcgcgccggctcctgcttctctccgcgctggtcagcctttgcctgggcttcggc
gcgcacgggacagaactgcccagtcctccttctgtgtggtttaaagccaaatttttccag
cacatcctccactgggtacctatcccaaatccatcggaaaacaccagctatgaagtggcc
ctcatgaggtacggaagcaggctctggaagacaattcccagctgtagccaggccttggag
ttgtcctgtgatctcaccaacttcaccctggacctataccacagcaatggctacagggcc
aaagtccgagcaatagacggcagccagcattccaactggaccctcaccaaaacccgcttc
actctggatgaagtgactctgacagtggatggcgtgacccttgaggcgctcaacggctat
atctttgggacgatccatctccctggatcccaggtggcccctgagggcaacacataccaa
gacatcttcgaatatttccgcacttatacgattgccttccgtaaagtgccagaacgaacg
ttcaaaataaagatggttaatcgtgagaactttagcctctcattcccaggagaggtggga
gagttctgtgtcaaggtgatgccaaatgtggaatcccgagctaacaaggcggaatggtcg
gaggaacagtgtttacatctcaccaagcagtatttcacggtgaccaacctcagtatcatc
ttcacttccatcctgctatttagtggagccctggtctgcctggccctccagctctatgtg
cggcgccgggggaagctacctgcagtcctgatcttcgagaagaccagccctttcttcctg
gtcaactttccctgccctgacacttacaacaccatccacatcttagacctggtgaccttc
cagaaggtgtcaccagagctgaaggactcagaccttcatggcagcacagacagtggcttt
ggcagtggcaagccatcactgcagactgaaaagccccaattcctcctccctggcccacac
ccccagacacaggaggctctgggaaagggggaacccccagagctgcaggacagccatagt
gatggcagcagcgacagcacagacagtgggatctgcctgcaggaacccagcttacacccc
agcacaagacctacctgggagcagcaggttgtgggcaccagccagggccaagatgacagt
ggcattggcctagttccaaactctgaaggacagcctgagcatacaaaaagtggctctcac
ttgggacatgtcagtctactagggcctgcagtccctgaggaagaagcaccagctgtggtg
gcagtccagggctacctgaaacagactagatacacggaagacatgacaaacccaacaggc
tgcctggaggaagaggtttccttgatagatgcttttgaccctaaactgaggacgtgcttg
caagccgagtcagattggccttccctggctctggccaaaggttatttgaaacaggatacc
ccagggatgactctggttcccacggggaccccaggtgaacactggaatcaactgcctgaa
gagtggccactcctggtcttacctagctgtgaagaccccaacacagttagctggagtttt
gcccatgatcctgcccctctagactgtgtggcagcccccggtggcctcctgggcagcttt
gattccaacctggtcgccctgccgctgatctccagcctacacacagaggattga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748643
Entry
103748643         CDS       T03372                                 

Gene name
Il2rb
Definition
(RefSeq) interleukin 2 receptor subunit beta
  KO
K05069  interleukin 2 receptor beta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04144  Endocytosis
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi05162  Measles
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103748643 (Il2rb)
   04151 PI3K-Akt signaling pathway
    103748643 (Il2rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103748643 (Il2rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103748643 (Il2rb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103748643 (Il2rb)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103748643 (Il2rb)
   04659 Th17 cell differentiation
    103748643 (Il2rb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103748643 (Il2rb)
   05202 Transcriptional misregulation in cancer
    103748643 (Il2rb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103748643 (Il2rb)
   05162 Measles
    103748643 (Il2rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103748643 (Il2rb)
   04090 CD molecules [BR:ngi04090]
    103748643 (Il2rb)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL2 receptor family
   103748643 (Il2rb)
CD molecules [BR:ngi04090]
 Proteins
  103748643 (Il2rb)
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 103748643
NCBI-ProteinID: XP_008849571
LinkDB
Position
Un
AA seq 541 aa
MAATALSWSLSLLLILLSLATSRVCATEKDKSHLKCFYNSRANVSCVWSSEEAVEATTCH
IHAQSDSRPWNKTCKLRPVRRASWACDLILGSLDSQSLTSADFVNMSVVCWEGGRWHMVK
TQGFRPFENLRLMAPHSLKVLLVETQTCNISWQVSQVSHYIIQDLEFEVRTQSPGRSWED
MPLLSLKQWQQWICLEKLTPDTLYEMQVRVRAQRGDHRTWSPWSQPLAFQTRPADPRKEI
LPISWVRHLLLSLGCIFGFLVCVGVLTKCQYLGPWLKTVLKCHVPDPSEFFSQLSSQHGG
DLQKWLSSPVPSSSFSPTGPMPEISPLEVLDQDTKATQLLLLQQDKVPSPSPGGQSQASC
FTNQGYFFFHLPDALEIEACQVYFTYDPCAEDEEDNGSELPSGSPLPSLPPLAGEDDAYC
TFPPGEDLLLFSPMLLGSQSTTSAALGGRSAPEERPALSPQEGPPALADPDLVGLQCPLE
LALQRGQEGVLNHSTGEGAIVPEASLCQQGQDRALTSGLALNTDAYLSLQELQAQDPAYL
V
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggctgccacagctctgtcctggagtctgtccctcctcctcatcctcctgtccctggct
acatctcgggtgtgtgcaacagagaaagacaagtcccatctcaagtgcttctacaactcg
agagccaatgtctcctgtgtgtggagctcggaagaagccgtggaggccacgacttgccac
atccacgcccagtcagatagtcggccctggaacaaaacctgtaagctgcgacccgtgagg
cgggcatcctgggcctgcgacctgatcctcggatccctagattcccagtcactgacctcg
gccgacttcgtcaacatgagcgtggtgtgctgggaaggggggcgctggcacatggtgaag
acccagggctttcggccctttgagaaccttcgcctgatggccccccactccctgaaagtc
ctgcttgtcgagacccagacatgcaacataagctggcaggtctcccaggtctctcactac
atcattcaagacttggaatttgaagtccgaactcagtctccaggccgcagctgggaggac
atgcccctgctgagcctcaagcagtggcagcagtggatctgcctggagaagctcaccccc
gacaccttgtatgagatgcaggtgcgggtcagggcgcagagaggtgaccacaggacctgg
agcccctggagccagcccctagcatttcagacaaggccagcagatcccaggaaggagatc
ctgcccatatcatgggtcagacacctcctcctgagccttggttgcatttttggcttccta
gtttgtgtcggcgtcctgaccaaatgccagtacctcgggccatggctgaagacagttctc
aagtgccatgtccccgatccttctgagttcttctcccagctgagctcccagcatggagga
gaccttcagaagtggctctcctccccagtcccctcatcctccttcagtcccactggcccc
atgcctgagatctctcccctggaggtgctggaccaggataccaaggccacgcagctgctc
ctgttacagcaagacaaggtaccttcaccctcacccgggggccagtcgcaagccagctgc
tttaccaaccagggctacttcttcttccacttgcctgatgccttggagatcgaggcctgc
caagtgtacttcacctatgacccctgtgccgaggatgaggaagacaatgggtctgagctg
ccttcagggtctcccctcccgtccctgccgcctctggctggggaggatgatgcctattgc
actttccctcccggggaagacctacttctcttctctcccatgcttcttggcagccagagc
accaccagtgctgcccttgggggacgttctgcccctgaagagaggccggccctttccccg
caggagggacctcctgccctagcagaccctgatttggtgggcttgcagtgccctctggag
ctggcgttgcaaaggggtcaggagggggttcttaatcatagcactggggagggggccatc
gtccctgaggccagcctttgccagcaaggccaggacagggctctgacctctggcctggct
ctgaacactgatgcctacctgtccctccaagaacttcaagcccaggacccagcctacctg
gtgtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748645
Entry
103748645         CDS       T03372                                 

Definition
(RefSeq) interleukin-3 receptor class 2 subunit beta-like
  KO
K04738  cytokine receptor common subunit beta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04210  Apoptosis
ngi04630  JAK-STAT signaling pathway
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103748645
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103748645
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103748645
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103748645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103748645
   04090 CD molecules [BR:ngi04090]
    103748645
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL3 receptor family
   103748645
CD molecules [BR:ngi04090]
 Proteins
  103748645
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind IL4Ra_N fn3 LIFR_N Tissue_fac Pur_ac_phosph_N IL2RB_N1 TTSSLRR
Other DBs
NCBI-GeneID: 103748645
NCBI-ProteinID: XP_017658236
LinkDB
Position
Un
AA seq 808 aa
MAVIQGLLRMALLTLFWRSNVTETQNTVPLQTLQCYYDYTSRIICSWADTEDAPELINVT
LYHWVNGDSPQPVSCDLSEDLLWSVCSPLHRCVPRRCVISYKSFEVSVEHFSFQLDRSLH
THLKVPLAQHVQPPPPKDIQVSPSGDHDAANLYTNDSWATLEPQLLLPSNTYVARVRTRL
SPGSNLSGRPSQWSPDVHWDSQPGDLAQPQNLQCLFDGAQMLNCSWEVRTQLHGSVVFGL
FYNSSPDAQEEECSPVEEQQAGLFIRYHCGINVSNASVHSRYTVSVKPRKQGKFIPSSNH
IQLPPPTLNLTKDGDSYRLDWDNRRTTHGNMFQVQYRRDLDTWKDSKTEAPQQAHSMLLP
ALKPATTYWARVRVMPALGYHGIWSEWSKEASWTTEWVLPTWGLALILVFVTLALLMALR
FGSVYGYRMNRKWKEKIPNPRKCISLQDTIGGLWPPGSMAAFSRGNCIPQGLQGCIFTVQ
EGVSFVHLEDSEVSPLTIEDPNMVQDPASGPGMTPAISSEPMEQPPDPQLDPLIPSSRLE
NQIPSFYFNGPYLGPSHNHSLLGLKGQSVTPETSGSLKPALPGSLVYLCLPPGGQAQLVP
MAQVMEQGQAMNVECGPSLGPERNLPMEAGDIPVPPDSGPKVRRHDLEENSVALPMSSGS
PEDPMVASGYITPADLITMPTGTAPSVSLSPSLGLPPAPNPSLCPRLPEGLLGSSTSRLP
CFEGYMELPPNMSLFPESSLGSLAPPVPSSPVVSLGAPREKVAPVSPHPEGLLVLQQVGD
YCLPPSTGVWPLPPQAKPSSPGWGQSSD
NT seq 2427 nt   +upstreamnt  +downstreamnt
atggcggtgatccaggggctgctccgaatggccctgctgactctgttctggagatccaat
gtgacagagacacaaaatactgtcccactgcagaccttgcagtgctactatgactacacc
agccgcatcatctgcagctgggcagacaccgaggacgccccagagctcatcaatgtgacc
ctctatcactgggtgaatggggactcgccacagccagtgtcctgtgacctcagtgaggac
ctgctctggtctgtgtgctcaccactccaccgttgtgtgcccagaagatgtgttatttcc
tataagagctttgaggtctctgttgaacacttctcatttcaactggaccggtctttgcac
acccacctcaaggttccattggcccagcatgtccagcccccacctcccaaggacatccaa
gtcagcccctctggggaccatgatgccgccaacctctatactaacgactcctgggccacc
ctggagccacagctgctcctgcccagcaacacctatgtggcccgtgtgcgcacccggctg
tccccaggctcgaatttgtctggaaggcccagccagtggagccctgatgttcactgggac
tcccagccaggggacctggcccagcctcagaacctgcagtgcctcttcgatggggcccaa
atgctcaactgctcctgggaggtgcggacccagctacatggctctgtcgtctttggactc
ttctacaactccagccctgatgctcaggaggaagaatgctctccagtggaggagcagcag
gctggcctcttcatccggtatcactgtgggataaatgtgtccaacgccagtgtacacagc
cggtacacagtctctgttaagccgcggaagcaagggaaattcattccaagctccaaccac
atccagctgccccctccaaccctcaacctgaccaaggatggagacagctatagattggac
tgggataataggagaacaacccacggaaacatgttccaagtccaatacaggagggacctg
gacacctggaaggacagcaagacagaggccccacagcaggcccacagcatgctgctgcca
gcactgaaacctgccaccacatactgggccagggtgagggtcatgcccgccctcggctac
catgggatctggagcgagtggagcaaggaggcctcctggactactgagtgggtactgccc
acatggggactggccctcatcctggtcttcgtcaccctggccttgctcatggccctccgt
tttggcagtgtctatgggtacaggatgaataggaagtggaaggagaaaattcctaacccc
aggaaatgtatctcattacaggacacaattggaggactctggcctcctggcagcatggca
gccttctccaggggtaactgtattccccaggggctgcagggctgcatcttcactgtgcag
gagggggtgtcgtttgtacatttggaggatagtgaggtgtcacctctcaccatcgaggac
cctaatatggtccaagatccagcatctgggcctggcatgaccccagccatctcatcagaa
cccatggagcagccccctgacccccagctagacccactaatcccttcaagcaggctggaa
aaccagatccccagcttttatttcaatggcccctacctggggccttcccacaaccactct
ttgcttggcctcaagggccagtcagtgaccccagagacaagtgggagcctgaagccagca
ctgccaggttccctggtatacctgtgtctgccccctgggggacaggcgcagctggtccca
atggcccaggtgatggagcagggccaggctatgaatgtggagtgtgggcctagcctgggg
cctgagaggaacctccccatggaagctggggacatccctgtccctcctgattctgggcca
aaggtgaggagacatgacctggaggagaactcagtggctctgcccatgagttctgggagc
cctgaggaccctatggtggcctctggttatattacccctgcagacttgatcaccatgcct
acagggacagctccatctgtctctctgtccccctctctggggttgcccccagccccaaat
cccagcctctgtcccaggctgcctgaagggctccttggatcctcaacctccaggctgcca
tgttttgagggctatatggagctccctccaaacatgagcctgtttccagagtcctctctg
ggcagtcttgcccctcctgtgcccagcagccctgtcgtgagtctaggagcaccccgggag
aaggtggccccagtatcccctcaccccgagggcctccttgtcctgcagcaggtgggagac
tactgcctgccccccagcactggagtctggccactccctccacaagccaagccctcctct
ccaggatgggggcagagctcagactaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748646
Entry
103748646         CDS       T03372                                 

Definition
(RefSeq) cytokine receptor common subunit beta-like
  KO
K04738  cytokine receptor common subunit beta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04210  Apoptosis
ngi04630  JAK-STAT signaling pathway
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103748646
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103748646
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103748646
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103748646
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103748646
   04090 CD molecules [BR:ngi04090]
    103748646
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL3 receptor family
   103748646
CD molecules [BR:ngi04090]
 Proteins
  103748646
SSDB
Motif
Pfam: fn3 IL4Ra_N Interfer-bind IL2RB_N1 TTSSLRR Pur_ac_phosph_N IL6Ra-bind Tissue_fac
Other DBs
NCBI-GeneID: 103748646
NCBI-ProteinID: XP_017658237
LinkDB
Position
Un
AA seq 843 aa
MALTQGLLHMALLALCWRPSVTETQDTVPLQTLQCYNDYTSRIICSWADTEDAQGLINMT
LYRRLDSDQAVSCDISENLLWSSCPSPHRCVPRRCVIPYNLFVVADEDYYSFQPDRELGI
QLTVPLDQHVQPPPPKDIQVPGTSEGTGLHGEGGEPTSMMNNSSLCNQPIPVDFMHEDHG
NLCDLIPCQHCCDKADAIYNMIGYPNFIMDPKELDKVFNDWMSVSILGYNSSPDAQEEEC
SPVEEQQAGLFIHYHCGINVSNPSAHSRYTVSVKPRKQGKYIPSSNHIQMPSPTLNVTKD
GDTYNLHWETEKMSYSHINHQFQVQYKMDSVNWEDSKTETVKQAHSMLLPALKPATAYGA
RVRVMPTPGYHGIWSEWSKEASWTTEWVLPTWGLALILVFITLALLTALRFGSVYGYRLN
KRWKEKIPNPRKCILFQDGPAGFWPPHSMGPFITKSPTPQGPRGSLFTELEGVSSPHLGE
SEVSPLTIEDPNIIQDPPSGPDTTPAASSEPMEQHPNPHLDPSVPSDRPESQIPSFDFNG
PYLGPPHSRSLPDLVGQPVPPQTGGSLKSALPGSLEYLCLPPGGQVQLVPLAQAMEQGQA
VDVECELSLGAKGSPSTEFGDKPSPEPRVEGKDPRDNQVALPMSFGGPEDPVVASGYVTP
ADLVLTVPSGTQSLSLAPSLGSPSTQSLSLCLGLTGGSPGTAAPGPQGFEGYVELPPSTS
QSPSSSLCNSILPVPSSPVVSLEEPREEGAPASPHPEGLLVLQQVGDYCFLPGLGPGSLS
PRSKPSSPSLCPEMEDLDQVLPVKKLPYQQAPQVPAIQFFKSLKQQDYLSLPPWDFGRSR
EVC
NT seq 2532 nt   +upstreamnt  +downstreamnt
atggcgctgacccagggtctgctccacatggccctgctggctctgtgctggagacccagt
gtaacagagacacaagacactgtcccactgcagaccttacagtgttacaacgactacact
agccgcatcatctgcagctgggcagacactgaggatgcccaggggctcatcaacatgacc
ctctatcgccgactagacagtgaccaggcagtgtcttgtgatatcagtgagaacctactg
tggtcaagctgcccctcaccccaccgctgcgtacccaggagatgcgtcattccttacaat
cttttcgttgtcgcggatgaagactactactcattccaaccagaccgagagctgggcatc
cagctcacagttcccctggaccaacatgtccagcccccacctcccaaggacatccaagtg
ccagggacttcagagggcactgggcttcatggggaagggggagaacccacttccatgatg
aacaactcttccctctgtaaccagcccattcctgtggacttcatgcatgaggaccatgga
aatctgtgtgacctaatcccctgtcagcactgctgtgataaagctgatgccatctacaac
atgataggctaccccaacttcatcatggaccccaaggagctggacaaagtgttcaatgat
tggatgtcagtgagtatcctgggctacaactccagccctgatgctcaggaggaagaatgc
tctccagtggaggagcagcaggccggcctcttcatccattatcactgtgggataaatgtg
tccaaccccagtgcacacagccggtacacagtctctgttaagccgcggaagcaagggaaa
tacattccaagctccaaccacatccagatgccctctccaacccttaatgtgaccaaggat
ggagacacttacaacctgcactgggaaacagagaaaatgtcctactcccacatcaaccac
cagttccaggtccagtacaagatggattcagtcaactgggaggacagcaagacagagacc
gtaaagcaggcccacagcatgctgctgccagcactgaaacctgccaccgcatacggggcc
agggtgagggtcatgcccacccccggctaccatgggatctggagcgagtggagcaaggag
gcctcctggaccactgagtgggtactgcccacatgggggctggccctcatcctggtcttc
atcaccctggccttgctcacggccctccgttttggcagtgtctatgggtacaggttgaat
aagaggtggaaggagaaaatccccaaccccaggaagtgcatcctgttccaggatggacct
gcagggttctggcctccccacagcatgggacccttcatcaccaagagccccactccccag
gggccaaggggcagcctcttcactgagctagagggggtgtcatctccacatttgggggag
agtgaagtgtcacctctcaccattgaagatcctaacattatccaagatccaccatctggg
cctgacaccaccccagctgcctcatcagaacccatggaacagcaccctaacccccaccta
gacccatcagtcccctcagacaggcctgagagccagattcccagctttgacttcaatggc
ccctacctgggacctccccacagccgttccctgcctgaccttgtgggccagccagtgccc
ccacagacaggtgggagcctgaagtcagctctgccaggctccctggagtacctgtgtctg
ccccctgggggacaggtgcagctggtcccactggcccaagcaatggagcagggccaggct
gtggatgtggaatgcgagctcagcctaggggccaaggggagcccttccacagaatttggg
gacaagccttcacctgagccaagggtagaggggaaggacccaagggataatcaggtggct
ctgcccatgagctttgggggccctgaggaccctgtggtggcctctggttatgtgactcct
gcagacctagtactcaccgtgccctcagggacccagtctctctccctggccccctctttg
ggatccccctcaacccagagcctcagcctctgtctcgggctgactggaggttcccctgga
actgcagcccctgggccacaaggatttgagggctacgtggagctccctccgagcacaagc
cagtcccccagttcatctctgtgcaattctatccttcctgtgcccagcagccctgtagtg
agcctggaggagcccagggaggagggggccccagcatccccacaccctgagggcctcctt
gtcctgcaacaggtgggagactactgcttcctccctggcctggggcctggctccctctcg
cctcgcagcaagccctcctcccctagcctttgtcccgagatggaggatctagaccaggtt
ctgcctgtcaaaaagcttccctaccagcaggcgccccaggtgcccgccatccagttcttc
aaatccctgaagcagcaggactacctgtctctgccaccttgggacttcggccgctccagg
gaggtgtgctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748852
Entry
103748852         CDS       T03372                                 

Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04144  Endocytosis
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04520  Adherens junction
ngi04540  Gap junction
ngi04630  JAK-STAT signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04926  Relaxin signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi05160  Hepatitis C
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103748852
   04012 ErbB signaling pathway
    103748852
   04014 Ras signaling pathway
    103748852
   04015 Rap1 signaling pathway
    103748852
   04630 JAK-STAT signaling pathway
    103748852
   04066 HIF-1 signaling pathway
    103748852
   04068 FoxO signaling pathway
    103748852
   04020 Calcium signaling pathway
    103748852
   04072 Phospholipase D signaling pathway
    103748852
   04151 PI3K-Akt signaling pathway
    103748852
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103748852
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103748852
   04520 Adherens junction
    103748852
   04540 Gap junction
    103748852
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103748852
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103748852
   04915 Estrogen signaling pathway
    103748852
   04921 Oxytocin signaling pathway
    103748852
   04926 Relaxin signaling pathway
    103748852
   04928 Parathyroid hormone synthesis, secretion and action
    103748852
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103748852
   05206 MicroRNAs in cancer
    103748852
   05205 Proteoglycans in cancer
    103748852
   05230 Central carbon metabolism in cancer
    103748852
   05231 Choline metabolism in cancer
    103748852
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103748852
  09162 Cancer: specific types
   05210 Colorectal cancer
    103748852
   05212 Pancreatic cancer
    103748852
   05225 Hepatocellular carcinoma
    103748852
   05226 Gastric cancer
    103748852
   05214 Glioma
    103748852
   05218 Melanoma
    103748852
   05219 Bladder cancer
    103748852
   05215 Prostate cancer
    103748852
   05213 Endometrial cancer
    103748852
   05224 Breast cancer
    103748852
   05223 Non-small cell lung cancer
    103748852
  09172 Infectious disease: viral
   05160 Hepatitis C
    103748852
   05171 Coronavirus disease - COVID-19
    103748852
   05163 Human cytomegalovirus infection
    103748852
   05165 Human papillomavirus infection
    103748852
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103748852
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103748852
   01522 Endocrine resistance
    103748852
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103748852
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103748852
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103748852
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   103748852
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103748852
  Exosomal proteins of pancreatic cancer cells
   103748852
  Exosomal proteins of bladder cancer cells
   103748852
SSDB
Motif
Pfam: Recep_L_domain Furin-like GF_recep_IV
Other DBs
NCBI-GeneID: 103748852
NCBI-ProteinID: XP_008849862
LinkDB
Position
Un
AA seq 544 aa
MLLSGTAGTALLALLAALLAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNALYENTYALA
VLSNYGTNKTGLRELPMRNLQEILLGAVRFSNNPILCNVETIQWRDIVNIDFMSNMSMDL
QNHLSSCQKCDPGCPNGSCWGAGEENCQKLTKIICAQQCSRRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCHKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKTCPRNYV
VTDHGSCVRACGPDNFEVEEDGVRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTAISGDLHILPVAFKGDSFTHTPPLDPKELNILKTVKEITGFLLIQAWPENWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISTNQNLCYANTINWKKL
FGTSSQKTKIQYNRAENDCKATGHVCNPLCSLEGCWGPEPRDCVSCQNVSRGRECVEKCN
ILDG
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgctactctcggggactgcggggaccgcgctgctggcgctgctggccgcgctcctggcc
gcaggtggggcgctggaggaaaagaaagtttgccaaggcacgagtaacaggctcacccag
ctgggcacttttgaagaccactttctgagtctgcagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaatcacttacgtgcaaaggaattatgacctttccttcttaaag
accattcaggaggttgctggctatgtgctcattgcactcaacactgtggagaagatccct
ttggagaacctgcagatcatcagaggaaatgctctatatgaaaacacctatgccttagcc
gtcctgtccaactacgggacgaacaaaactgggctgagggagctgcccatgcggaactta
caggaaatcctgcttggtgctgtgcgattcagcaacaaccctatcctctgcaatgtggag
actatccagtggagggacatcgtcaacatcgactttatgagcaacatgtcaatggactta
cagaaccatctgagcagctgccaaaaatgtgacccaggctgtcccaatggaagctgttgg
ggtgcaggagaggaaaactgccagaaactgaccaaaatcatctgtgcccagcagtgttcc
cggcgctgccgtggcaagtctcccagtgactgctgtcacaaccagtgtgccgctggctgc
acagggccccgagagagcgactgcctggtttgccacaagttccgggatgaggccacatgc
aaggatacctgcccaccgctcatgctgtacaaccccaccacataccagatggatgtcaac
cctgaggggaagtacagctttggtgccacctgtgtgaagacatgcccccgaaactacgtg
gtgacagatcatggttcatgtgtccgcgcctgcggtcctgataactttgaagtggaagaa
gacggtgttcgcaagtgtaaaaaatgtgatgggccctgtcgcaaagtttgcaatggcata
ggcattggtgaatttaaagacacactctccataaatgctaccaatatcaaacacttcaaa
aactgcactgccatcagtggagatctccacatcctgccggtggcatttaagggggactcc
ttcacacacactcctcctctagacccaaaggaactgaatatcctaaaaaccgtaaaggaa
ataacagggtttttgctgattcaggcttggcctgaaaactggactgaccttcatgctttt
gagaacctagaaattatacgtggcaggacaaagcaacatggtcagttttctcttgcggtt
gtcggcctgaacataacatcattgggattgcgttcccttaaggaaataagtgatggtgat
gtgataatttcaacaaaccaaaatttgtgttatgcaaatacaataaactggaaaaaacta
tttgggacttccagtcagaaaaccaaaattcaatacaacagagctgaaaatgactgcaag
gctacaggccacgtctgtaatcctttatgttccctggaaggctgctggggccctgagccc
agggactgtgtctcctgccagaacgtcagccggggcagggaatgcgtggagaagtgcaac
atcctggatgggtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750113
Entry
103750113         CDS       T03372                                 

Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha-like
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103750113
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103750113
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103750113
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103750113
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103750113
   04090 CD molecules [BR:ngi04090]
    103750113
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL3 receptor family
   103750113
CD molecules [BR:ngi04090]
 Proteins
  103750113
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N
Other DBs
NCBI-GeneID: 103750113
NCBI-ProteinID: XP_008851274
LinkDB
Position
Un
AA seq 439 aa
MQRSRKACRGGGSDQLRPWGAGPPPHRTPLPQPRAPALPVRAVSPLVLCLVLLPPAFLGT
PEPAAVTPQEPEPELNVTFNPRTWTLTWACRENVTVTMCIVTKAGGPRPSTKPRKDACGC
TFRRLLLHQGLSLEVQATVNRTVIRQKLAYVNPGANGTAAQNLSCSIHLASVMMCTWEPG
PVAPPDVQYYLYIKDLSERTEWECPQYLGDSVVHTGCRVQNLSGLPSESYVLLNGTSRRE
AIQFLDAMLDSKEIERLSAPHNITVTCNASHCRVTWRRPRTWARLSFWDFKYELDIQRQN
VDPGRRNPTISVSSNADDKYDFPSPEPRPLHTARIRAGDVRSDKWSPWSPEVTFGSGESR
FPLLYVYVAVVLLTVFCALGLGFACKRVVHARSLFPPIPQIKDKVTDSDAADPQTLSNFE
PSVQKAEPEEFTSVEEVRT
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcagcgcagccgcaaagcatgccggggggggggttcagaccagctgcgcccatgggga
gcggggccgcctcctcaccgcacgcctctcccgcagccccgcgcccccgcactccccgtg
cgcgccgtgtcgcccctggtgctgtgcttggttctcctgcccccggcattcctcgggaca
ccggaacctgcagctgtgacgccccaggaacccgagcctgagctcaatgtgacattcaac
ccccggacctggacgctgacctgggcctgtcgggaaaacgtcaccgtcaccatgtgcatc
gtgaccaaggctggagggcccaggcccagcaccaagcccaggaaggacgcgtgtggttgc
acgttccgacggctgctcctgcaccaaggactgagtctcgaagttcaagccaccgtcaac
cggaccgtcattcgccagaaactcgcttacgtcaacccaggtgcgaacgggacggcggcc
cagaacctgtcctgctccatccacttggcgagtgtcatgatgtgcacgtgggaaccgggg
cctgtggcgccgccagacgttcagtactatttgtacatcaaggacctgagtgaaagaaca
gagtgggaatgtccccagtacctcggagactcagttgtccacaccgggtgccgtgtgcaa
aacctgtccgggttacccagcgagagctacgtcctgctgaatggaaccagccgccgggag
gccattcagttcctggacgccatgttggattccaaggagatcgagcgactcagtgcaccg
cacaacatcactgtgacttgcaacgcatcccactgccgcgtgacatggcggaggccgcgg
acctgggcgcgcttgtccttctgggacttcaagtacgagctggacatccagcgacagaat
gtggacccaggcaggagaaatcccacgatctccgtgtccagcaacgctgacgacaaatac
gactttccgagcccggagccccgacctctgcacacggcgcggatccgagccggggacgtg
cgcagcgacaagtggagcccgtggagcccagaagtgacgttcggctccggggaaagcagg
ttcccgctgctgtacgtctacgtcgccgtggtgctgctgaccgtgttctgtgccctgggc
ctgggcttcgcctgtaagagggtcgtccacgcgagaagcctgttccccccaatcccccag
atcaaggacaaagttaccgatagcgacgcggctgacccgcagacactgagcaacttcgag
cccagtgtgcagaaggctgagcccgaggagttcacgtccgtagaggaagtcaggacctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750124
Entry
103750124         CDS       T03372                                 

Gene name
Crlf2
Definition
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103750124 (Crlf2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103750124 (Crlf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103750124 (Crlf2)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL2 receptor family
   103750124 (Crlf2)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 103750124
NCBI-ProteinID: XP_008851294
LinkDB
Position
Un
AA seq 356 aa
MFVCLCRLSGFPALTCPPDDRPPPRSTRDELPVGILCFNLETMHVTWNAHDAGGANLTFI
YRFAPEPFRPCPSYMLRGGLTAGCVFPARLALLDFSLLDGNITLLNEKHFASQYLQPRAP
SNVSFTWRNDGVTVTCTDLPLQGLRYEVQHRSAEDPDWQSREENTCDITVPGLDSERCYD
FRARVTTRPSIYGADARPSSWTDVTHWRGARRTESCTAQPAESAFPALSVALGLLTALGV
LGLCALARVWKRLLPGVPDPKCSFPGLFDQHDGNFQEWISDTERVAPLPRDGKGQDGGAE
EVLLVQLCDAEAQPAPQTEVLCAQSLCLPRRGAQPGDAVALGGFTFLVNEDAYMVL
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgttcgtgtgtctgtgtcgtctttccgggtttccggcgctcacatgtcccccggacgac
cgtccccctccgaggagcaccagggacgagctcccggttggcatcctgtgcttcaacctg
gagaccatgcacgtgacgtggaacgcccacgacgccggcggcgccaacctgacgttcatc
tacaggtttgcccccgagccgttccggccgtgcccaagctacatgctccgcgggggcctc
acggcgggttgcgtgttcccggcacggttggcgctgctggacttctccctcctggacggc
aacatcacgctgctcaacgagaagcacttcgcctctcagtacctgcagccgcgggccccg
agcaacgtgtccttcacgtggcggaacgacggcgtcacggtgacctgcaccgacctcccg
ctgcaggggctgcgctacgaggtccagcaccgcagcgctgaggaccctgactggcagtcc
cgggaggagaacacgtgtgacatcacggtgccaggcctggactccgagcgctgctacgac
ttccgggcccgtgtgactacacgaccgtccatctacggcgccgacgctcggcccagcagc
tggacggacgtgacgcactggcggggtgccagacgcacagagtcctgcacggcacagcct
gctgagagcgcgttccccgcgctgagcgtcgcgctcggcctcctgacggcgctcggggtg
ctggggctgtgcgcgctggccagggtctggaagcgcctgctgcccggcgtgcccgacccc
aagtgcagcttccctgggctcttcgaccaacacgacggaaacttccaggagtggatcagc
gacaccgaacgcgtggcgccactgcccagagacggcaaaggccaggatggcggcgcggag
gaggtgctgctcgtacagctctgcgatgccgaggcgcagcccgccccgcagactgaggtg
ctgtgtgcacagtcgctctgtctcccccgccggggcgcgcagcccggagacgcggtggca
ctgggcggcttcacatttctggtgaatgaagacgcttacatggtgctataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750125
Entry
103750125         CDS       T03372                                 

Gene name
Il3ra
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04210  Apoptosis
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103750125 (Il3ra)
   04151 PI3K-Akt signaling pathway
    103750125 (Il3ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103750125 (Il3ra)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103750125 (Il3ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103750125 (Il3ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103750125 (Il3ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103750125 (Il3ra)
   04090 CD molecules [BR:ngi04090]
    103750125 (Il3ra)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL3 receptor family
   103750125 (Il3ra)
CD molecules [BR:ngi04090]
 Proteins
  103750125 (Il3ra)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind LIFR_N
Other DBs
NCBI-GeneID: 103750125
NCBI-ProteinID: XP_017658659
LinkDB
Position
Un
AA seq 823 aa
MWCLALNPAGPDPGLGLLHPQVQLHAVALLEFLFLLFLLIGTSCGGDQHLARGGDSPVVN
LTLDVRRKTLTWNYETHVTRHTCNVTTRVDPSTVTEPLLRGGSWLCWFPNARFHGGAVLT
VGGETEDGRAFEEVLFFHNSGKEGSGAVNFSCVIYDIRFMNCTWAPGPAAPVDVQYRLCA
WLSRDAEAQECAQYLPGRLGCHFPELGAPRTTDDYVFLVDGTSRTDAVAFVDFAPLSAVM
LEKYNPPENLTVAHEDSGTVIRWENPERRFNLAPSTFWYQLHIQSQGSSQEREPICQRGH
ERNEYRVPSTESKTEHTCIYIHALKSTGTTHLTAGSHFLCHLCAAAVGGVTSASISTLRP
QIRVRVPGGSSLRQRLCPSIPKVKVELAEGFCPGAEFPGRPWGAQAGRGGRPRPPEAELR
TQLRFYGRKLLNRAQTAPTMAPLWLLVLLTPGSVLLTPDPDPGAPGPFRNLRLEPNERRL
SWEMDAHGPTGSPVLCQKDAQNPVVASQQTCTFYTLSLCNITRFTVYVRDDPATSTWIRF
PKDDPNRGAAASNLQCWVYHTDTLTCTWEPGRTAPGDVQYRLFWRKAGSGRDQDQECLHY
GQDTLGRNVRCDVSNVSLVSHLLMVTVNGSSQQEPVSCSDRSVHLKSVEVLSPPEITAQC
NRTHALMRWSMRSLFPRTFTYHLEIRQSSTFVSNTTTKETSFVLLHPGTFTVRIRAKSDE
QIRYTAWSARQSFVCDDSADTQVLTVALLVSLGMVLMALVTLLLLCRRSSLWQSLCPPIP
KVKGLLTQGDPEVTWVEANLPESLQEPEEFLRVEEAAGRPPAT
NT seq 2472 nt   +upstreamnt  +downstreamnt
atgtggtgcttagcactgaatcctgcaggtcctgaccctggtcttggtctgttgcatccc
caggtccagctccacgctgtggccctgctggagttcctcttcctcctgttccttctgatt
ggcacatcctgtggaggagaccagcacctggcccgaggtggagactcgccggtcgtgaac
ctgacgctcgacgtccggaggaaaacgctgacgtggaattacgagacccacgtcacgcgt
cacacatgcaacgtcaccacccgcgtggacccctccacggtcactgagcctctgctccgc
ggcggctcgtggctctgctggtttccgaacgcgcggttccacggaggcgcggtgctgacg
gtgggcggcgagaccgaggacggcagagcgttcgaggaagtcctcttcttccacaactca
gggaaggaagggtccggggccgtgaacttctcctgcgtcatctacgacatccggttcatg
aactgcacgtgggcgccgggccccgcggcgcccgtggacgtccagtaccgcctgtgtgct
tggttgtccagggacgccgaggcgcaggaatgcgctcagtacctccccggccgcctcggc
tgccacttcccggagctcggggcgccgcggaccacggacgactacgtgttcctggtagac
gggaccagtcgcacagacgccgtggccttcgtggactttgctcccctttccgccgtgatg
ctcgaaaagtacaatcctcctgaaaacctgacggtcgcccacgaagattcggggaccgtc
atccggtgggaaaacccggagaggcgattcaacttagcaccgagcaccttctggtaccaa
cttcacatccaaagccagggaagctcccaggagagagaaccgatttgtcaacgcggacat
gagagaaatgagtaccgagtacccagtaccgagtcgaagacagagcacacctgcatttac
atacatgcactcaagtccactggcaccacccacctcaccgcgggttcccacttcctctgc
catctctgtgcagctgctgtgggcggggtgacatcagcatccatctccaccctgaggccc
cagatccgggttcgggtcccgggagggtcctccctgaggcagaggctatgcccgtccatc
cccaaggtgaaagtggagctggccgagggcttctgtcctggtgccgagtttcccgggcgg
ccttggggtgcacaggcggggcggggggggagaccccgacccccggaggccgagctgagg
acgcagctgcgtttctatggccggaagttgctcaaccgcgctcagactgcgcccaccatg
gcccccctgtggctcctcgtcctgctgacgccggggtctgttttgctgacccctgaccct
gacccgggtgcgcccggccctttcaggaacctgcgactggagcccaacgagcgtaggctg
agctgggagatggatgcacacggccccactggttcgccagtcctgtgtcagaaggatgca
cagaatccggtggtggcttctcagcagacgtgcacgttctacacgctgtccttgtgcaac
atcacccggttcaccgtctacgtgcgggacgacccggccacatccacctggatccgcttc
cccaaggacgatcccaaccgcggggctgcggcctccaacctgcagtgctgggtgtaccac
accgacaccctgacctgcacctgggagcccggccgcacggcccccggcgacgtgcagtac
cggctgttctggaggaaggcgggttccgggagggaccaggaccaggagtgtctgcactac
ggccaggacaccctggggcgcaacgtgcgctgtgacgtcagcaacgtctccctggtctcc
cacctgctcatggtgacggtgaacggatccagccagcaggaaccagtgtcctgcagcgac
cgatccgtgcatctgaagagtgtagaggtgctgagtcctcccgagatcacggcccagtgt
aacagaacccacgcgctcatgcgctggagcatgaggagcctcttccctcggacgttcact
taccacctggagatccggcagagctcaacttttgtgtccaacacgacgaccaaggaaacc
tccttcgtcctgctgcatccgggaaccttcaccgtccggatccgcgcgaagtcggatgag
cagatccgctacaccgcctggagcgctcggcagtcgtttgtgtgcgacgactctgcggac
acccaggtgctgactgtggcgctgctggtgtccctggggatggtgctcatggccttggtg
accctattgctgttgtgcagaaggtcctccctgtggcagtcgctgtgcccccccatcccc
aaggtgaaagggctgctgacacaaggtgatcccgaggtcacatgggtggaggcaaatctt
ccagaaagtctgcaggagcctgaggaattcctccgggtggaagaagctgcagggcgtcca
ccagcaacatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751211
Entry
103751211         CDS       T03372                                 

Gene name
Il5ra
Definition
(RefSeq) interleukin 5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103751211 (Il5ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103751211 (Il5ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103751211 (Il5ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103751211 (Il5ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103751211 (Il5ra)
   04090 CD molecules [BR:ngi04090]
    103751211 (Il5ra)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL3 receptor family
   103751211 (Il5ra)
CD molecules [BR:ngi04090]
 Proteins
  103751211 (Il5ra)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind Tissue_fac
Other DBs
NCBI-GeneID: 103751211
NCBI-ProteinID: XP_008852802
LinkDB
Position
Un
AA seq 443 aa
MGRRGPWHLLLSTGGMESIASEQDLTIVVPVFLILLGATATLQVDLLPDKKLLLLPPVNF
TIKVTGLAQVLLHWDPNPNREQRNIKLQYHVKINSPQEDEYDTRKTESKYVIPLHEGFTA
SVRTILENSHSFLASSWVSAELKAPPGAPGTSVVNLTCTTNTAMNNRTHLRPYRVSLLCT
WLVGKDAPEDTQYFLYYRYGFWTEECQEYSTDALNRNTACWFPRTFINSKGLEQLAVHVN
GSSKHAAIKPLDQLFFLHAIDQVNPPMNVTAEIEGTSLSILWEKPVSAFPVQCFDYELKI
CNMKNGYFQMEKLTTNKFISKIDDVSTYSIQVRAAVSSTCRMAGNWGEWSQPIYMGGEQK
PLAEWFLILLPATICFILLIFSLICRVCHLWTKLFPPVPVPKNNIKDLLVVTNCEKTGSN
ETEVEIISYVKEPGFEIFENSMF
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgggcagacgtggtccttggcacctactgctgagcactggtggaatggagagcattgct
agtgaacaggatttgaccatcgtggtacctgtatttctaattcttctgggggctacagca
acattgcaagtggatttacttcccgacaaaaagcttttacttctaccacctgtcaatttc
actattaaagttactggattagctcaagttcttttacattgggacccaaatcctaatcga
gagcaaaggaatattaagctccaatatcatgtgaaaataaactccccacaagaagatgag
tatgataccaggaagactgaaagcaaatatgtgattccccttcacgaaggctttacagcc
agtgtgcggaccattttggagaacagtcactccttcctggccagcagctgggtttctgct
gaacttaaagctccaccaggagctcctggaacctcagttgtgaatttaacttgcaccaca
aacactgccatgaataatcgcacacacttaaggccataccgagtttctcttctatgcacc
tggcttgttggcaaggatgcccctgaagacacacagtatttcctctactataggtatggc
ttttggacggaagaatgccaggaatacagcacagatgctctgaacagaaacactgcatgc
tggtttcccaggacatttatcaacagcaaagggcttgagcagcttgcagtgcatgttaac
ggctcaagcaagcatgccgctatcaagcccttggatcagctgttcttcctgcatgccatc
gatcaagtaaatcctccgatgaatgtcacagctgagattgagggaacttctctctctatc
ctatgggagaaacccgtttctgcctttccagtccagtgctttgattatgagttgaaaatc
tgcaacatgaagaatggttactttcagatggaaaaactgacaaccaacaaattcatctca
aaaattgatgatgtctctacgtactctattcaagtgagagcagctgtgagctccacatgc
agaatggctgggaactggggcgagtggagtcaacctatttacatgggaggtgagcagaag
cccttggcagaatggtttctcatcctgcttccagccaccatctgcttcatcttgttaatt
ttctcactcatctgcagagtgtgtcacttatggaccaagttgtttccaccagttccagtg
ccaaagaataacatcaaagatctcttagtggtgaccaactgtgagaaaactggttccaat
gaaacagaagttgaaatcataagttatgtgaaagagcctggatttgagatctttgaaaat
tccatgttttga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751364
Entry
103751364         CDS       T03372                                 

Gene name
Il6r
Definition
(RefSeq) interleukin 6 receptor
  KO
K05055  interleukin 6 receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04066  HIF-1 signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04659  Th17 cell differentiation
ngi04932  Non-alcoholic fatty liver disease
ngi05163  Human cytomegalovirus infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103751364 (Il6r)
   04066 HIF-1 signaling pathway
    103751364 (Il6r)
   04151 PI3K-Akt signaling pathway
    103751364 (Il6r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103751364 (Il6r)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103751364 (Il6r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103751364 (Il6r)
   04659 Th17 cell differentiation
    103751364 (Il6r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103751364 (Il6r)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103751364 (Il6r)
   05163 Human cytomegalovirus infection
    103751364 (Il6r)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103751364 (Il6r)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103751364 (Il6r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103751364 (Il6r)
   04090 CD molecules [BR:ngi04090]
    103751364 (Il6r)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL6/12 receptor family
   103751364 (Il6r)
CD molecules [BR:ngi04090]
 Proteins
  103751364 (Il6r)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 Ig_2 ig Ig_5 fn3 I-set
Other DBs
NCBI-GeneID: 103751364
NCBI-ProteinID: XP_008852982
LinkDB
Position
Un
AA seq 709 aa
MSPQIPKPTPFCCLSEAAFEERLSVENEPLGRPSCLRLTESESVGVDPDSAVFLGLPRGL
QWAVPPIVTGRDTAPPLRLSRCAFHCVIVFASRKQNSKPERVGLPRALQPGEGQADPALP
AVRTPLSSRSGARGQEAVPSGGPGALGCCAIGRAFVTAHRACQEALQCQFLKRFPALPGR
SSALSHGQVGSRRTDSQRARRGAEQRVLLSRGPRLAPGLSPPVAPPRPSSHPGSARLRPA
EGSMLAVRCALLTALLTAPSAAASRSCRALEVANDTVASLPGATVTLTCPGMEPENNTTV
YWVHNGSNLRRWASVGRNLLLRLVQPSDSGNYSCYVDGQQAGTVRLLVDVPPEKPNLHCF
RKNPLMNVVCEWRPHHKPSETTKAVLNVKKLKLSFTTEFQVPCQYSQEFQNFSCQVAILE
DNNAFYVVTLCVANSVGSKSSNDVSFEAIRIVQPDPPVNLVVTAMPGNPHWLNVSWQDPE
SWDPYYYLLQYEVRYRPEWSKTSTVWDHWESSCLHSQIKNLEKKPKKTYHHCIIQDALRG
MKHVVQIRGKEEFGIGKWSEWTPEVTCTPWIDTRSTPRTPTEPPDEEDYDEDLYRISTGT
TETPGQESSSASLATFLVAGGSLAFGLLLCVGVVLRLKKTWKAQAGKECKTNSPPPYSPG
QLKPTVVLVPLLTQAAPPRSSNTLSHNCPDAGEPQSPYDISNRDYFFPR
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgtccccacagattccaaagcccacaccgttttgttgcctttctgaagcagccttcgaa
gagaggctgagtgttgagaatgaacctttaggacgtccgtcttgcctcaggctgactgaa
tcagaatctgtgggggtcgacccagatagcgctgtttttttagggctccccagagggttg
cagtgggcagtgccccctattgtaacaggcagagacacagcacctcctctaagactttcc
aggtgcgcctttcactgcgtaatcgttttcgcttcgcgaaagcaaaactcaaaaccagag
cgggtggggctgcccagagcgctccaacctggggagggtcaggcggatcctgcgctccct
gcggtccggaccccgctgagctcccgctcaggtgcgcgggggcaggaagccgtcccctct
ggtggccccggtgcgctgggctgttgcgccatcggtcgggctttcgtaactgcacaccgg
gcctgccaagaggcgcttcagtgccagttcctcaaacgttttcctgcgttgccaggacgg
tcctcggctctgagtcatgggcaagtgggaagtcgtcgcacggacagccagcgagcgcgg
cgaggggccgaacagagagtgcttctgagccggggaccacgacttgccccggggctgagt
cctcccgtcgccccgcccaggccgagcagtcatcccggctccgcacggctgcggcctgca
gaaggaagcatgctggccgtacgctgcgcgctgctgaccgcgctgctgaccgcgccctcc
gcggcggcctcccggagctgccgagcgctcgaggtggcaaatgatacggtggcgagtctg
ccgggggccactgtcaccctgacctgcccagggatggaaccagaaaacaataccactgtt
tactgggtgcacaatggctcaaacctcagaagatgggctagtgtgggaagaaatctactt
ctgagattggtgcagcccagcgactccgggaactattcatgctacgtggatggccagcaa
gctgggactgtgcgcttgctggtagatgttcctccagagaaacccaatctccactgcttc
cggaagaatccactcatgaacgttgtttgtgagtggcgtcctcatcacaaaccctctgaa
acgaccaaggctgtgctgaatgtgaagaagctcaagctcagtttcacgactgagttccag
gtgccctgccagtattctcaggagttccaaaacttctcctgccaggtggcaatcctagag
gacaataatgctttctacgtagtgaccctatgcgtggccaacagtgtcggaagcaagtcc
agcaatgatgtgtcattcgaggccataagaatagtgcagcctgacccacctgtcaacctt
gtggtcacagccatgccgggaaaccctcactggctcaatgtcagctggcaagaccctgag
tcctgggacccatattactacctgctacagtatgaggttcgataccggccagaatggtca
aagacatccacagtgtgggaccactgggagtcatcatgtctccattctcagatcaagaac
ctcgagaagaaacccaagaagacctatcatcactgcatcatccaggatgccttgagaggc
atgaaacacgtggtgcagatccggggaaaggaggagtttgggattggcaagtggagcgag
tggaccccggaggtcacgtgtactccttggatagataccaggagcactccgaggaccccc
acggagccccctgatgaagaagactatgacgaggatctctacagaatttctacaggaaca
acagagacccccggtcaagaatcttcctccgcatcactggccacattcttggtggctgga
ggaagtctggcctttggattgctcctttgtgttggtgttgttctgaggctcaagaagaca
tggaaggcacaggctggaaaagaatgcaagacaaactcacccccaccatactccccggga
cagctgaagcccactgtggtgcttgttccactcctcacccaagcagcgcccccccgcagc
agcaacaccttgagccacaactgcccagatgccggggaaccacagagcccttacgacatc
agcaacagagactacttcttccccagataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751909
Entry
103751909         CDS       T03372                                 

Gene name
Il27ra
Definition
(RefSeq) interleukin 27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103751909 (Il27ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103751909 (Il27ra)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103751909 (Il27ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103751909 (Il27ra)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL6/12 receptor family
   103751909 (Il27ra)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 103751909
NCBI-ProteinID: XP_008853736
LinkDB
Position
Un
AA seq 643 aa
MRLSQAVRLAPLGLLLPLLLLLPRTRSHRSLGPLQCYGAGPLGNLNCSWEPLGLPGTPVL
HHQSQKYHSNRTQEVKVPARQSWVTIPREQFTMSDKILIWGTQEGQLLWPPILVNLETQM
KPDTPQLFPDVDFSVDELLEATVRWVPPKWPSHKVLICQFQYKRCQEEEWTELEPQLKTN
QLVPVEIQDLEPCTGYQVSGRCLVEDGYPWGEWSPGLSFQTPSSAPENVWVSRNFCETSG
TQTALLLWEALGPCVQVTYRVWYGVGNSTVTQEVVSCCKSSIPAWAEWAAVSVVNTTSWA
HLTNLSLICLAPESAPHGVVVSSIDQGPKLLVTWQQEIQEPQKYVVDWAPDGDSPENISW
IHLPAGNHSTLLPGDFEGGVPYRITVTAVFPGGMAPAPSVWGFIEELVPLAGPTLWRLQD
DPPGTPAVAWGEVPRVQLRGRALHYTLCAQSGVSPAVCMNVSSNTQTASLPDLHPGSFKL
WVTVSTVAGQGPPGPNLWLHLPDNRIRWKILPWLLSLWGVLLMLCSLRLATTRRCLHLRN
KMFPRWVWEKVPDPANSNSGQPHIKEVILSQPPRDWPILEVEEMESLPATELPKASAPFH
SGYEKHFLPTPEELGLLSHPTPRFQPEPCASGWKLQPNLGLDF
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgcgcctgtcccaggctgtgcgcctcgcgccgctgggattgctgctgccgctgctgctg
ctgctgccccggacgcggtcccaccgcagcctcgggccactgcagtgctacggtgccgga
cccttggggaacctgaactgctcctgggagcctctagggctcccagggacacctgtgctg
caccaccagagtcaaaaatatcattcgaacagaactcaggaggtgaaggtgcctgccagg
cagagctgggtgaccattcctcgggagcagttcacgatgtccgacaaaatcctcatctgg
gggacccaggagggccaacttctgtggccccctatccttgtgaacctggaaacccaaatg
aaaccggacaccccccagctcttccctgatgtggacttctctgtggatgagctcctggag
gccactgtacgatgggtgcccccaaagtggccatctcataaggttcttatctgccagttc
caatacaaaagatgccaggaggaagagtggaccgagctggagccacagctcaagaccaac
cagctggtccctgttgaaatacaggacttggaaccttgcactggttaccaggtatcaggc
cgctgcctagtggaggatggatatccctggggagagtggagcccaggcctgtcctttcag
actccatcctcagctcctgaaaatgtgtgggtatccaggaacttctgtgagacatctggc
acacagacagccctgctcctctgggaggccctggggccctgtgtgcaggtaacttacaga
gtttggtatggggttggaaattctactgtgactcaggaagtggtctcttgttgcaagtct
tctatccctgcatgggcagagtgggctgcagtgtccgtagtcaacaccaccagctgggca
catctcaccaacctgtctttgatctgcttggctccggaatctgccccccatggtgtggtg
gtcagcagcattgatcagggcccaaagctgctggtgacctggcaacaggagatccaggaa
ccacagaagtacgtggtggactgggctccagatggggacagcccagagaacatcagctgg
atccatctccccgctggaaaccacagcactctattaccaggggattttgaaggaggggtc
ccctatcgcatcaccgtgacagcagtctttcctgggggcatggctcctgctccttcagtc
tggggattcatagaggagttagtaccccttgctggaccaacactttggcgtctccaagat
gaccccccagggacacctgcagtagcatggggagaggtcccaagagttcagctccgaggc
cgagctttgcactataccttgtgtgcccagagtggagtcagccctgcggtctgcatgaat
gtgagcagtaacacccagactgcctctctgcctgacctccacccaggatccttcaagctt
tgggtgacagtgtccactgttgcaggacagggcccacctggtcctaacctctggcttcac
ctaccagataataggatcaggtggaagattctgccctggctcctgtccctgtggggtgtg
ctcctgatgctctgtagcctgaggctggccaccaccagaaggtgcctccacctgcgaaac
aagatgtttccccgctgggtctgggagaaggttcctgaccctgccaacagcaattctggc
cagcctcacataaaggaggtgatcctgtcccagccaccccgggactggcccatcctggaa
gtggaggaaatggagtcactgcctgccacagagctccctaaggcttctgcccctttccac
tctgggtatgaaaaacatttcctgcccacaccagaggagcttggccttctgagccaccca
acccccaggttccagcctgagccttgtgcttcaggctggaagctgcaacccaatcttgga
ttagacttttga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751955
Entry
103751955         CDS       T03372                                 

Gene name
Il2rg
Definition
(RefSeq) interleukin 2 receptor subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04144  Endocytosis
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi05162  Measles
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05321  Inflammatory bowel disease
ngi05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103751955 (Il2rg)
   04151 PI3K-Akt signaling pathway
    103751955 (Il2rg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103751955 (Il2rg)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103751955 (Il2rg)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103751955 (Il2rg)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103751955 (Il2rg)
   04659 Th17 cell differentiation
    103751955 (Il2rg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103751955 (Il2rg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103751955 (Il2rg)
   05162 Measles
    103751955 (Il2rg)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103751955 (Il2rg)
   05340 Primary immunodeficiency
    103751955 (Il2rg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    103751955 (Il2rg)
   04090 CD molecules [BR:ngi04090]
    103751955 (Il2rg)
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL2 receptor family
   103751955 (Il2rg)
CD molecules [BR:ngi04090]
 Proteins
  103751955 (Il2rg)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 103751955
NCBI-ProteinID: XP_008853806
LinkDB
Position
Un
AA seq 369 aa
MLKSSLSFSCFLLLQLPLLGVGLSSKVLMPSRNEDIEADFFLTSVAPGPLNVSTPPLPVV
QCFVFNVEYMNCTWNSSSEPQSTNLTLHYRYMRSDNDKFQECGHYLFSEEITSGCWLQKE
EIQLYQTFVVQLQDPQKPQRQAEQKLNLQNLVIPWAPVNLTLYNLSESQLELTWNSRYTE
RCLQHLVQYRSDRDRGWTEQIVDHAPRFSLPSVDWQKLYTFRVRSRFNPLCGSTQYWSKW
SQPIYWGSNASKENPSVFALETVLIPIGSMGLIITLVFVYCWLERAMPRIPTIKNLEDLV
TEYHGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGEALGEGPEEFPCSLHSPYWPP
PCYTLKPEA
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaagtcatcactgtcattcagttgcttcttactcctgcagctgcctctgctgggg
gtagggctgagctccaaagtcctcatgcccagtaggaatgaagacatcgaagctgatttc
ttcctgacttcagtggctcctggtcccctcaatgtttccactccacctctcccagtagtt
cagtgctttgtgttcaatgtcgagtatatgaattgcacttggaatagcagctctgagccc
cagtctaccaacctgactctgcactacaggtacatgagatctgataatgataaattccag
gagtgtggccactatctgttctcagaagagattacttctggctgttggttacaaaaagag
gagattcagctctaccaaacatttgtcgtccagctccaagatccccagaaacctcagagg
caggctgaacagaagctaaacctgcagaatcttgtgatcccctgggctccggtgaatcta
acactttacaacctgagtgaatcccagctagaactgacctggaacagcagatatacagaa
cgctgcttacaacacttggtgcagtaccggagtgatcgagatcgcggctggactgaacaa
atagtggatcatgcaccaagattctccctgcctagtgtggactggcagaaactgtacaca
ttccgagttcgaagccgctttaacccactctgcggaagtactcaatactggagtaaatgg
agccaaccaatctactgggggagcaatgcttcaaaggagaatccttctgtgtttgcgctg
gaaactgtgctcatccccattggctccatgggattgattattaccctggtctttgtgtat
tgttggttggaacgggccatgcctcgaattcccaccatcaagaatctagaggatctggtt
actgaataccacgggaacttttcggcctggagtggtgtgtctaaaggactgactgagagt
ctgcagccagactacagtgaacggttctgccacgtcagtgagattcccccaaaaggagag
gctcttggagaggggcctgaagagtttccttgcagcctgcatagcccctactggccaccc
ccatgttatacgctgaagcctgaagcataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 108490034
Entry
108490034         CDS       T03372                                 

Definition
(RefSeq) interleukin-15 receptor subunit alpha-like
  KO
K05074  interleukin 15 receptor alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04672  Intestinal immune network for IgA production
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108490034
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108490034
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    108490034
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108490034
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108490034
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ngi04050]
    108490034
   04090 CD molecules [BR:ngi04090]
    108490034
Cytokine receptors [BR:ngi04050]
 Interleukin receptor families
  IL2 receptor family
   108490034
CD molecules [BR:ngi04090]
 Proteins
  108490034
SSDB
Motif
Pfam: Sushi EACC1
Other DBs
NCBI-GeneID: 108490034
NCBI-ProteinID: XP_017650348
LinkDB
Position
Un
AA seq 250 aa
RALATQRETLKAAARGTTCPTPTSVEHADIRVKNYNVNSRERYVCNSGFKRKAGTSTLTE
CVLNKTTNVAHWTTPNLKCIRDPTLARQRPVPPSTVVTPRATPEPKSPSPPGKEIPTEPE
ALSPKPNTTVASETALVPGSQLAPSQPPSAGTTGTGSHESSQAPSPTTAKTLEPSSSTSL
RTPGVSPHSSKTIAVAVSTSFILGSIVFAVLLACYLRSRQTSRPPRVEVETMEAVPMTVR
TSTKEEDMGT
NT seq 755 nt   +upstreamnt  +downstreamnt
cccgagctctggccacccagagggaaactttgaaagctgcagcccgaggcaccacgtgcc
caactcccacatctgttgaacatgcagacattcgggtcaagaattacaatgtgaactcca
gggagaggtacgtttgtaactctggtttcaagcggaaagccggcacttccaccttgacag
agtgtgtgttaaacaagacaacaaatgttgctcactggacaacgcccaatctcaaatgca
tcagagaccccaccctggctcgccaaaggccagtgccaccctccacagtagtgactccaa
gggcgaccccagagccaaagagcccctcccctcctggaaaagaaattcctacagaaccag
aagctttatctcccaagccaaataccacagtggcctcagagacagctcttgtgccaggtt
cccagctggcaccatcccaaccaccttctgcaggaaccacagggacaggcagtcatgagt
cttctcaagccccatctcccacaacagcaaagaccctggagccttcatcctccacctccc
tcaggacaccaggggtttctccacacagctccaaaacgatagctgtggccgtctccacat
ctttcatcctgggttctatagtgtttgcggttttactggcatgctacctcagatcaaggc
aaacttcccggccacctcgcgtcgaggtggaaaccatggaagctgtgccaatgactgtga
ggaccagtaccaaagaggaagacatgggaacctaa

DBGET integrated database retrieval system