KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724994
Entry
103724994         CDS       T03372                                 

Gene name
Rela
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01523  Antifolate resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04064  NF-kappa B signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04137  Mitophagy - animal
ngi04151  PI3K-Akt signaling pathway
ngi04210  Apoptosis
ngi04211  Longevity regulating pathway
ngi04218  Cellular senescence
ngi04380  Osteoclast differentiation
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04623  Cytosolic DNA-sensing pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04657  IL-17 signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04668  TNF signaling pathway
ngi04722  Neurotrophin signaling pathway
ngi04917  Prolactin signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04926  Relaxin signaling pathway
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05030  Cocaine addiction
ngi05132  Salmonella infection
ngi05133  Pertussis
ngi05134  Legionellosis
ngi05135  Yersinia infection
ngi05140  Leishmaniasis
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05146  Amoebiasis
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05203  Viral carcinogenesis
ngi05212  Pancreatic cancer
ngi05215  Prostate cancer
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05222  Small cell lung cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05321  Inflammatory bowel disease
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103724994 (Rela)
   04014 Ras signaling pathway
    103724994 (Rela)
   04064 NF-kappa B signaling pathway
    103724994 (Rela)
   04668 TNF signaling pathway
    103724994 (Rela)
   04066 HIF-1 signaling pathway
    103724994 (Rela)
   04071 Sphingolipid signaling pathway
    103724994 (Rela)
   04024 cAMP signaling pathway
    103724994 (Rela)
   04151 PI3K-Akt signaling pathway
    103724994 (Rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103724994 (Rela)
  09143 Cell growth and death
   04210 Apoptosis
    103724994 (Rela)
   04218 Cellular senescence
    103724994 (Rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103724994 (Rela)
   04621 NOD-like receptor signaling pathway
    103724994 (Rela)
   04622 RIG-I-like receptor signaling pathway
    103724994 (Rela)
   04623 Cytosolic DNA-sensing pathway
    103724994 (Rela)
   04625 C-type lectin receptor signaling pathway
    103724994 (Rela)
   04660 T cell receptor signaling pathway
    103724994 (Rela)
   04658 Th1 and Th2 cell differentiation
    103724994 (Rela)
   04659 Th17 cell differentiation
    103724994 (Rela)
   04657 IL-17 signaling pathway
    103724994 (Rela)
   04662 B cell receptor signaling pathway
    103724994 (Rela)
   04062 Chemokine signaling pathway
    103724994 (Rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103724994 (Rela)
   04917 Prolactin signaling pathway
    103724994 (Rela)
   04926 Relaxin signaling pathway
    103724994 (Rela)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103724994 (Rela)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103724994 (Rela)
  09149 Aging
   04211 Longevity regulating pathway
    103724994 (Rela)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103724994 (Rela)
   05202 Transcriptional misregulation in cancer
    103724994 (Rela)
   05203 Viral carcinogenesis
    103724994 (Rela)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103724994 (Rela)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103724994 (Rela)
   05221 Acute myeloid leukemia
    103724994 (Rela)
   05220 Chronic myeloid leukemia
    103724994 (Rela)
   05215 Prostate cancer
    103724994 (Rela)
   05222 Small cell lung cancer
    103724994 (Rela)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103724994 (Rela)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103724994 (Rela)
   05022 Pathways of neurodegeneration - multiple diseases
    103724994 (Rela)
  09165 Substance dependence
   05030 Cocaine addiction
    103724994 (Rela)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103724994 (Rela)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103724994 (Rela)
   04931 Insulin resistance
    103724994 (Rela)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103724994 (Rela)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103724994 (Rela)
   05135 Yersinia infection
    103724994 (Rela)
   05133 Pertussis
    103724994 (Rela)
   05134 Legionellosis
    103724994 (Rela)
   05152 Tuberculosis
    103724994 (Rela)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103724994 (Rela)
   05170 Human immunodeficiency virus 1 infection
    103724994 (Rela)
   05162 Measles
    103724994 (Rela)
   05164 Influenza A
    103724994 (Rela)
   05161 Hepatitis B
    103724994 (Rela)
   05160 Hepatitis C
    103724994 (Rela)
   05168 Herpes simplex virus 1 infection
    103724994 (Rela)
   05163 Human cytomegalovirus infection
    103724994 (Rela)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103724994 (Rela)
   05169 Epstein-Barr virus infection
    103724994 (Rela)
   05165 Human papillomavirus infection
    103724994 (Rela)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103724994 (Rela)
   05145 Toxoplasmosis
    103724994 (Rela)
   05140 Leishmaniasis
    103724994 (Rela)
   05142 Chagas disease
    103724994 (Rela)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103724994 (Rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103724994 (Rela)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    103724994 (Rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 103724994
NCBI-ProteinID: XP_008820421
LinkDB
Position
Un
AA seq 548 aa
MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVCDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFRSIMKKSPFNGPTDPQPPPRRIAVPSRSSSSIPKPASQPYTFPTSLSTINF
DEFPPMVLPSGKISNQAVTPSSAPVLTQTLVPPSAMAPALAHTPVPVSVVAPCAPQAMAP
PIPKTTQAGEGTLSEALLHLQFDADEDLGALLGNSADTGVFTDLASVDNSEFQQLLNQGV
SMSHPTAEPMLMEYPEAITRLMTGSQRPPDPAPTSLGTSGLPNGLSGDEDFSSIADMDFS
ALLSQISS
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggacgacctgtttcccctcatcttcccctcagaaccagcccaggcttcaggcccctat
gtggagatcatcgagcagccaaagcagcggggcatgcgattccgctacaagtgcgagggt
cgctcagcaggcagtatcccaggagagaggagtacagataccaccaagacacaccccacc
atcaagatcaatggctacacaggaccaggaacagttcgcatctccctggtcaccaaggac
ccacctcatcggcctcacccccatgaacttgttgggaaggactgccgggatggcttctat
gaagctgagctctgtccagaccgctgcatccacagcttccagaacctggggatccaatgt
gtgaagaagcgagacctggagcaagccatcagccagcgcatccagaccaacaataaccct
ttccaagtccccatagaagagcagcgtggggactatgacctgaatgcggtgcggctctgc
ttccaggtgacagtgtgtgacccatcaggcaggcccctccgcctgccacctgtcctctct
catcctatctttgataaccgcgcccccaacaccgccgagctcaagatctgccgagtgaac
cgaaactctgggagctgcctcggtggagatgagatcttcctgctgtgtgacaaggtgcag
aaagaggacattgaagtgtatttcacgggacccggctgggaggcccgaggctccttttct
caagctgatgtgcatcggcaagtggccattgtgttccggacccctccctacgcagacccc
agcctgcaggctccagttcgagtctccatgcagctccggaggccttctgaccgggagctc
agcgagcccatggagttccagtacctgccagacacagacgatcgccaccggattgaggag
aaacgcaaaaggacatacgagaccttccggagcatcatgaagaagagccctttcaatgga
cctaccgacccccagcctccaccccggcgtattgctgtgccttcccgaagctcatcttcc
atccccaaaccagcctcccagccctatacctttccaacatccctcagcaccatcaacttt
gatgagtttccccccatggtgttaccttctgggaagatctcaaaccaggccgtgacacca
tcctctgccccagtcctgacccagacattggtccccccctcagccatggcaccagctctg
gcccataccccagttcctgtgtcagttgtagccccatgcgctccccaagccatggcccca
cctatcccaaagaccacccaggccggggaaggcacactgtcggaagcactgctgcaccta
cagttcgatgctgatgaagacctgggggccttgctcggcaacagcgcagacacaggcgtg
ttcacggacctggcatctgtcgacaactcagaatttcagcagctgctgaatcagggtgta
tccatgtcccaccccacagctgagcccatgctgatggagtaccccgaggctataactcgc
ctgatgacaggttcccagaggccccctgacccagcacctacatccctggggacctcggga
ctccccaatggcctctcaggggatgaagacttctcctccattgcggatatggacttctct
gctcttctgagtcaaatcagctcctaa

DBGET integrated database retrieval system