KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725010
Entry
103725010         CDS       T03372                                 

Gene name
Fosl1
Definition
(RefSeq) FOS like 1, AP-1 transcription factor subunit
  KO
K04502  fos-like antigen 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04310  Wnt signaling pathway
ngi04380  Osteoclast differentiation
ngi04657  IL-17 signaling pathway
ngi05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103725010 (Fosl1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    103725010 (Fosl1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103725010 (Fosl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103725010 (Fosl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103725010 (Fosl1)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    103725010 (Fosl1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF3450 Macoilin TMCO5 UPF0242
Other DBs
NCBI-GeneID: 103725010
NCBI-ProteinID: XP_008820452
LinkDB
Position
Un
AA seq 274 aa
MYRDFGDPGPSSGPGSAYGGPAQPSAATQATQQQKFHLVPSVNAVSGSQELQWMVQPHFL
GPSGYPRPLAYPQYTPPQPRPGVIRTLGPPPGVRRRACEQISPEEEERRRVRRERNKLAA
AKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGDK
KDRGATSSASHPSSPPAPCRPVPCISLSPGSVLEPEALHTPTLMTTPSLTPFTPTLVFTY
PSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
NT seq 825 nt   +upstreamnt  +downstreamnt
atgtaccgagacttcggggacccgggacccagctccgggccgggcagcgcgtacggaggc
cccgcgcagccctcggcggctacgcaggcgacccagcagcagaagttccaccttgtgcca
agtgtcaacgctgtgagtggcagccaggaattacagtggatggtgcagcctcacttcctg
ggccccagcggctatccccgacctctggcctacccccagtacacccccccacagccccgg
ccaggagtcatacgaaccctggggccacctccaggagtacgtcgaagggcctgtgaacag
atcagcccagaggaggaggagcgccgtcgagtgaggcgggaacgcaacaagctggccgct
gccaagtgcaggaaccgaaggaaggaactgaccgacttcctgcaggcggagacagacaaa
ttggaggatgagaaatctgggctgcagcgagagatcgaggagctgcagaagcagaaggag
cgccttgagctggtgctggaggcccatcgccccatctgcaaaatcccagaaggagacaaa
aaggacagaggggctaccagcagtgccagccaccccagcagccctccagccccctgccgc
cctgtcccgtgtatctctctttctccaggctctgtacttgaacctgaggcattgcacacc
cccaccctcatgaccacaccctcgctgactccttttactcccaccctggttttcacctat
cctagcacaccagagccttgtgcctcagctcatcgaaagagcagcagcagcagcggggac
ccctcctctgaccctctaggatcccccacactccttgccttgtga

DBGET integrated database retrieval system