KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725143Help
Entry
103725143         CDS       T03372                                 

Gene name
Park7
Definition
(RefSeq) Parkinsonism associated deglycase
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05012 Parkinson disease
    103725143 (Park7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ngi01002]
    103725143 (Park7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103725143 (Park7)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     103725143 (Park7)
Peptidases [BR:ngi01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   103725143 (Park7)
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103725143 (Park7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 103725143
NCBI-ProteinID: XP_008820666
LinkDB All DBs
Position
Un
AA seq 189 aa AA seqDB search
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED
AKKQGPYDVVVLPGGNLGAQNLSESGLVKEILKEQESRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDRMMNGSHYSYSESRVERDGLILTSRGPGTSFEFALAIVEALNGKEVAEQ
VKAPLVLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaaagagctctggtcatactggccaaaggagcagaggagatggagaccgtt
attcctgtggatgtcatgaggcgagctgggattaaagtcaccgtcgcaggattggctggg
aaagaccctgtgcagtgcagccgtgatgtggtcatttgtcctgatgccagtcttgaagat
gcaaaaaagcagggaccatatgatgtggtggttctgcctggaggaaatctgggggcacag
aatttatctgagtctggtctggtgaaggagatcctgaaggagcaggagagcaggaagggc
ctcatcgccgccatctgtgcaggtcctacagccctgttggctcatgaaataggttttgga
agcaaagttacaacacacccgcttgctaaggacagaatgatgaatgggagtcactacagc
tactcagagagccgtgtggagagggacggcctgatcctcaccagccgtgggcccggaacc
agcttcgagtttgcgttggccatcgtggaagcgcttaatggcaaggaggtggctgagcag
gtgaaggcgccactcgtcctcaaagactag

DBGET integrated database retrieval system