KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725210
Entry
103725210         CDS       T03372                                 

Gene name
Cdk6
Definition
(RefSeq) cyclin dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04110  Cell cycle
ngi04115  p53 signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04218  Cellular senescence
ngi04934  Cushing syndrome
ngi05160  Hepatitis C
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05206  MicroRNAs in cancer
ngi05212  Pancreatic cancer
ngi05214  Glioma
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103725210 (Cdk6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103725210 (Cdk6)
   04115 p53 signaling pathway
    103725210 (Cdk6)
   04218 Cellular senescence
    103725210 (Cdk6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103725210 (Cdk6)
   05206 MicroRNAs in cancer
    103725210 (Cdk6)
   05203 Viral carcinogenesis
    103725210 (Cdk6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103725210 (Cdk6)
   05225 Hepatocellular carcinoma
    103725210 (Cdk6)
   05214 Glioma
    103725210 (Cdk6)
   05220 Chronic myeloid leukemia
    103725210 (Cdk6)
   05218 Melanoma
    103725210 (Cdk6)
   05224 Breast cancer
    103725210 (Cdk6)
   05222 Small cell lung cancer
    103725210 (Cdk6)
   05223 Non-small cell lung cancer
    103725210 (Cdk6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103725210 (Cdk6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103725210 (Cdk6)
   05164 Influenza A
    103725210 (Cdk6)
   05162 Measles
    103725210 (Cdk6)
   05163 Human cytomegalovirus infection
    103725210 (Cdk6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103725210 (Cdk6)
   05169 Epstein-Barr virus infection
    103725210 (Cdk6)
   05165 Human papillomavirus infection
    103725210 (Cdk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103725210 (Cdk6)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     103725210 (Cdk6)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CMGC group
  CDK family
   103725210 (Cdk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 103725210
NCBI-ProteinID: XP_008820769
LinkDB
Position
Un
AA seq 326 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYF
QDLERCKESLDSHLPSSQNTSELNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagccgcgcggaccagcagtacgaatgcgtggcggagatcggc
gagggcgcctacgggaaggtgttcaaggcccgcgacctcaagaacggaggccggttcgtg
gcactgaagcgcgtgcgggtgcagacgggtgaggagggcatgccgctctccaccatccgc
gaggtggcggtactgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtatgcacagtgtcacgaacagacagagaaactaaacttacactagtgtttgagcat
gttgatcaagacttgaccacttacttggataaagttccagagcctggagtgcccacagaa
accataaaggatatgatgtttcagcttctccgaggtctggattttcttcattctcacaga
gtagttcatcgtgatctaaaaccacagaacattctggtgaccagcagtggacaaataaaa
ctggctgactttggccttgcccgcatctatagttttcagatggcccttacctcagtggtc
gtcacactgtggtaccgagctccagaagtcttgctccagtccagctacgccacccctgtg
gacctctggagtgttggctgcatatttgcagaaatgtttcgcagaaagcctctttttcgt
ggaagttcagatgtggatcaactaggaaaaatcctggacgtaattggacttccaggggaa
gaagactggcctagagatgtggcccttcccaggcaggctttccattccaaatctgcccaa
cccattgagaagttcgtgacggacatcgacgaactaggcaaagacctacttctgaaatgc
ttgacatttaatccagccaagagaatatctgcctatggtgccctgaatcacccatacttc
caagacctggagagatgcaaggaaagcctagattcccacctgccatccagccaaaacacc
tcggagctgaacaccgcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742900
Entry
103742900         CDS       T03372                                 

Gene name
Cdk4
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04110  Cell cycle
ngi04115  p53 signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04218  Cellular senescence
ngi04530  Tight junction
ngi04660  T cell receptor signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04934  Cushing syndrome
ngi05160  Hepatitis C
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05212  Pancreatic cancer
ngi05214  Glioma
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103742900 (Cdk4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103742900 (Cdk4)
   04115 p53 signaling pathway
    103742900 (Cdk4)
   04218 Cellular senescence
    103742900 (Cdk4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103742900 (Cdk4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    103742900 (Cdk4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103742900 (Cdk4)
   05203 Viral carcinogenesis
    103742900 (Cdk4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103742900 (Cdk4)
   05225 Hepatocellular carcinoma
    103742900 (Cdk4)
   05214 Glioma
    103742900 (Cdk4)
   05220 Chronic myeloid leukemia
    103742900 (Cdk4)
   05218 Melanoma
    103742900 (Cdk4)
   05219 Bladder cancer
    103742900 (Cdk4)
   05224 Breast cancer
    103742900 (Cdk4)
   05222 Small cell lung cancer
    103742900 (Cdk4)
   05223 Non-small cell lung cancer
    103742900 (Cdk4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103742900 (Cdk4)
   04934 Cushing syndrome
    103742900 (Cdk4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103742900 (Cdk4)
   05160 Hepatitis C
    103742900 (Cdk4)
   05164 Influenza A
    103742900 (Cdk4)
   05162 Measles
    103742900 (Cdk4)
   05163 Human cytomegalovirus infection
    103742900 (Cdk4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103742900 (Cdk4)
   05169 Epstein-Barr virus infection
    103742900 (Cdk4)
   05165 Human papillomavirus infection
    103742900 (Cdk4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103742900 (Cdk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103742900 (Cdk4)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     103742900 (Cdk4)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CMGC group
  CDK family
   103742900 (Cdk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 103742900
NCBI-ProteinID: XP_008842269
LinkDB
Position
Un
AA seq 303 aa
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPEIEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEEA
DPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggccacctctcgatatgagccagtggctgaaattggtgtcggagcttatgggacggtg
tacaaggcccgtgatccccacagtggccacttcgtggctctcaagagcgtgagagtcccc
aatggaggagcagctggagggggccttcccatcagcacagttcgtgaggtggccttactg
aggaggctggaggcttttgagcatcctaatgttgtccggctgatggatgtctgtgctact
tcccgaactgaccgcgatatcaaagtgaccctagtgtttgagcatatagaccaggaccta
aggacatacttggacaaagcacccccaccaggcttgccagttgagaccatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgctaattgcattgttcaccgagac
ctgaagccagagaacattctggtgacaagtaatgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcccttacacctgtggttgttacactctggtac
cgtgctcctgaagtccttctgcagtctacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggcaactcagaagct
gaccagttgggcaaaatttttgatctgatcggattacctccagaagatgactggcctcga
gatgtatctctacccagaggagccttttcccccagagggcctcggcctgtgcagtcagtg
gtgccagagatagaagaatctggagcacagctgctgctggaaatgctgacttttaaccca
cataagcgaatctctgccttccgagccctgcaacactcttacctacacaaggaagaagct
gatcctgagtga

DBGET integrated database retrieval system