KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725310Help
Entry
103725310         CDS       T03372                                 

Gene name
Sdhb
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00020  Citrate cycle (TCA cycle)
ngi00190  Oxidative phosphorylation
ngi01100  Metabolic pathways
ngi01200  Carbon metabolism
ngi04714  Thermogenesis
ngi04932  Non-alcoholic fatty liver disease (NAFLD)
ngi05010  Alzheimer disease
ngi05012  Parkinson disease
ngi05016  Huntington disease
Module
ngi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ngi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ngi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103725310 (Sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103725310 (Sdhb)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103725310 (Sdhb)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    103725310 (Sdhb)
   05012 Parkinson disease
    103725310 (Sdhb)
   05016 Huntington disease
    103725310 (Sdhb)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103725310 (Sdhb)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103725310 (Sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 103725310
NCBI-ProteinID: XP_008820855
LinkDB All DBs
Position
Un
AA seq 280 aa AA seqDB search
MAAAVGVSLRCGFPAAAVGGVGLQAYRGAQTAAAAAPRIKKFAIYRWNPDKAGDKPRMQT
YEIDLNKCGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLACTRKIDSD
LNKVSKIYPLPHMYVIKDLVPDLNNFYAQYKSIEPYLKKKDESQEGKQQYLQSIADREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWIIDSRDDFTEERLAKMQDPFSV
YRCHTIMNCTLTCPKGLNPGKAIAEIKKMMAIYKEKRASG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggtcggggtctccttgaggtgcggcttcccggccgcggctgtcggcgga
gtcggcctgcaggcctaccgaggggcacagacagctgctgctgcagctccccgaatcaaa
aaatttgctatctacagatggaacccagacaaagctggagataaacctcgaatgcagact
tacgaaattgatctgaataagtgtggtcctatggtattggatgctttaatcaagattaag
aatgaaatggattccactctgaccttccgaagatcatgtagagaagggatctgtggctct
tgcgccatgaatatcaacggaggcaacaccctggcgtgcactcggaagattgactcggac
ctcaacaaagtctcaaaaatctaccctcttccgcatatgtatgtgatcaaggatctagtt
cctgatttgaacaacttctatgcacagtacaagtccatcgagccctatttgaagaagaag
gatgagtcccaggaaggcaagcagcagtacctgcagtccatcgcagaccgggaaaagctg
gatggactgtatgagtgtatcctgtgtgcctgctgcagcaccagctgccccagctactgg
tggaacggagacaagtacctcgggcctgcagttctcatgcaggcctaccgctggataatc
gactccagagatgacttcacagaggaacgcctggccaagatgcaggaccccttctctgtc
taccgttgccacaccatcatgaactgcacattgacctgccccaagggtctgaatccagga
aaagctatcgcagaaatcaagaagatgatggcaatctacaaggagaagagagcatctggt
tag

DBGET integrated database retrieval system