KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725580
Entry
103725580         CDS       T03372                                 

Gene name
Clcf1
Definition
(RefSeq) cardiotrophin-like cytokine factor 1
  KO
K05421  cardiotrophin-like cytokine factor 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103725580 (Clcf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103725580 (Clcf1)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103725580 (Clcf1)
SSDB
Motif
Pfam: PRF CNTF
Other DBs
NCBI-GeneID: 103725580
NCBI-ProteinID: XP_008821104
LinkDB
Position
Un
AA seq 279 aa
MSHTEKKNAKPREKNLRVGLADGIIKASPEPRLALPLRQPPGEEPRPAGPAPSPMDLRAG
DSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLG
PPFNEPDFNPPRLGAESLPRATVNLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAAT
AELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPAWAPGPAHSDFLQKMDDFW
LLKELQTWLWRSAKDFNRLKKKIQPPAAAVTLRLEAHGF
NT seq 840 nt   +upstreamnt  +downstreamnt
atgtcccacaccgaaaaaaaaaatgcgaaaccgagagaaaaaaacctgcgagtgggcctg
gcggatgggattattaaagcttcgccggagccgcggctcgccctcccactccgccagcct
ccgggagaggagccgcgcccggccggcccggcccccagccccatggacctccgagcaggg
gactcgtgggggatgttagcttgcctgtgcaccgtgctctggcacctccctgcagtgcca
gctctcaatcgcacaggggacccagggcctggcccctccatccagaaaacctatgacctc
acccgctacttggagcatcaactccggagcttggctgggacctacctgaactacctgggg
ccccctttcaacgagcctgacttcaaccctcctcggctaggggcagagagtctgccccgg
gccactgtcaacttggaagtgtggcgaagcctcaatgacaaactgcggctgacccagaac
tacgaggcgtacagccacctcctgtgttacttgcgtggccttaaccgtcaggctgccaca
gctgagcttcggcgcagcctggcccatttctgcaccagcctccagggcctgctaggcagc
atcgcaggcgtcatggcagctctaggctacccactgccccagcctctgccagggactgag
ccggcctgggcccctggccctgcccacagcgacttcctccagaagatggatgacttctgg
ctgttgaaggagctgcagacctggctgtggcgttcagccaaagacttcaaccggctaaag
aagaagatacaacctccagcagccgcagtcaccctgcgcctggaggcccatggcttctga

DBGET integrated database retrieval system