KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725586
Entry
103725586         CDS       T03372                                 

Gene name
Rps6kb2
Definition
(RefSeq) ribosomal protein S6 kinase B2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04012  ErbB signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04350  TGF-beta signaling pathway
ngi04371  Apelin signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04714  Thermogenesis
ngi04910  Insulin signaling pathway
ngi04931  Insulin resistance
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05221  Acute myeloid leukemia
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103725586 (Rps6kb2)
   04350 TGF-beta signaling pathway
    103725586 (Rps6kb2)
   04371 Apelin signaling pathway
    103725586 (Rps6kb2)
   04066 HIF-1 signaling pathway
    103725586 (Rps6kb2)
   04151 PI3K-Akt signaling pathway
    103725586 (Rps6kb2)
   04152 AMPK signaling pathway
    103725586 (Rps6kb2)
   04150 mTOR signaling pathway
    103725586 (Rps6kb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103725586 (Rps6kb2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    103725586 (Rps6kb2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103725586 (Rps6kb2)
  09149 Aging
   04211 Longevity regulating pathway
    103725586 (Rps6kb2)
   04213 Longevity regulating pathway - multiple species
    103725586 (Rps6kb2)
  09159 Environmental adaptation
   04714 Thermogenesis
    103725586 (Rps6kb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103725586 (Rps6kb2)
   05205 Proteoglycans in cancer
    103725586 (Rps6kb2)
   05231 Choline metabolism in cancer
    103725586 (Rps6kb2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103725586 (Rps6kb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103725586 (Rps6kb2)
   05212 Pancreatic cancer
    103725586 (Rps6kb2)
   05225 Hepatocellular carcinoma
    103725586 (Rps6kb2)
   05226 Gastric cancer
    103725586 (Rps6kb2)
   05221 Acute myeloid leukemia
    103725586 (Rps6kb2)
   05224 Breast cancer
    103725586 (Rps6kb2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103725586 (Rps6kb2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103725586 (Rps6kb2)
   05163 Human cytomegalovirus infection
    103725586 (Rps6kb2)
   05165 Human papillomavirus infection
    103725586 (Rps6kb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103725586 (Rps6kb2)
   01522 Endocrine resistance
    103725586 (Rps6kb2)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103725586 (Rps6kb2)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   103725586 (Rps6kb2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Pkinase_fungal Kinase-like Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 103725586
NCBI-ProteinID: XP_008821112
LinkDB
Position
Un
AA seq 485 aa
MAAVFDLDLETEEGSEAEGEPEFSPADVCPLAELRTAGLEPMGHYEEVELTESSVNLGPE
RIGPHCFELLSVLGKGGYGKVFQVRKVQGTNLGRIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLGEITL
ALGHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVHSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLVLPPYLTPDARDLA
KKFLKRNPIQRIGGGPGDAAEVQKHPFFRHINWDDLLARRVDPPFRPSLQSEEDVSQFDA
RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRT
PISPLKFSPFEGFRPSPGPPEPMEPPLPPLLPPPSPPPPTSTAPLPIRPPSGIKKSKKSR
GRPGR
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggccgtgtttgatctagacctggagaccgaggaaggcagcgaggcggagggcgag
ccagagttcagccctgcggacgtgtgtcccctcgccgagttgaggactgctggtttggag
cctatgggacactatgaggaggtggagctgacagagagcagcgtgaacctgggtcctgag
cgcattgggccccactgctttgaactcctgagtgtgcttggcaaggggggctatggcaag
gtgttccaggtgcgaaaggtgcaaggcaccaacttgggcagaatatatgccatgaaagtt
ctgaggaaggccaagattgtgcgcaatgccaaggacacagcacacacccgggctgagcgg
aacattctagaatctgtgaagcatcccttcattgtagaactggcctatgctttccagaca
ggtggcaaactctacctcatcctggagtgcctcagtggtggcgaactcttcacgcatctg
gagcgagaaggcatcttcctggaagacacagcctgcttctacctgggcgagatcacactg
gccctgggccatctccattcccaaggcatcatctacagggacctcaagccagagaacatc
atgctcaacagccagggccatatcaaactgacagactttggactctgcaaagagtccatc
catgaaggcgctgtcactcacaccttctgtggcactattgagtacatggcccctgagatt
ctggtgcacagtggccacaaccgggcagtggactggtggagcctgggggccctgatgtac
gacatgctcactggatcgccgcccttcaccgcagagaatcggaagaaaaccatggataag
atcatcaaaggaaagctggtgctgcccccctacctcaccccagatgcccgggaccttgcc
aaaaagtttctgaagcggaatcccatccagcggattgggggtggtccaggagatgctgct
gaggtacagaagcacccctttttccggcacatcaactgggatgacctcctggcccgccgc
gtggaccctcccttcaggccaagcctgcagtcagaagaggacgtgagccagtttgacgcc
cgcttcacacggcagactccagtggacagtccagatgacacagccctcagtgagagtgcc
aaccaagccttcctgggcttcacatatgtggcaccctctgtcctggacagcatcaaggag
ggtttctccttccagcctaagctgcgctcacccaggcgtctcaacagcagtccccgcacc
cctatcagccccctcaagttctctccctttgaggggttccggcccagccctggcccacca
gagcccatggagccacctctacctccacttctgccgccaccatcaccaccaccacccaca
agcactgccccccttcccatccgtcccccctcagggatcaagaaatccaagaagagccga
ggacgcccaggccgctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741760
Entry
103741760         CDS       T03372                                 

Gene name
Rps6kb1
Definition
(RefSeq) ribosomal protein S6 kinase B1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04012  ErbB signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04350  TGF-beta signaling pathway
ngi04371  Apelin signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04714  Thermogenesis
ngi04910  Insulin signaling pathway
ngi04931  Insulin resistance
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05221  Acute myeloid leukemia
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103741760 (Rps6kb1)
   04350 TGF-beta signaling pathway
    103741760 (Rps6kb1)
   04371 Apelin signaling pathway
    103741760 (Rps6kb1)
   04066 HIF-1 signaling pathway
    103741760 (Rps6kb1)
   04151 PI3K-Akt signaling pathway
    103741760 (Rps6kb1)
   04152 AMPK signaling pathway
    103741760 (Rps6kb1)
   04150 mTOR signaling pathway
    103741760 (Rps6kb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103741760 (Rps6kb1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    103741760 (Rps6kb1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103741760 (Rps6kb1)
  09149 Aging
   04211 Longevity regulating pathway
    103741760 (Rps6kb1)
   04213 Longevity regulating pathway - multiple species
    103741760 (Rps6kb1)
  09159 Environmental adaptation
   04714 Thermogenesis
    103741760 (Rps6kb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103741760 (Rps6kb1)
   05205 Proteoglycans in cancer
    103741760 (Rps6kb1)
   05231 Choline metabolism in cancer
    103741760 (Rps6kb1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103741760 (Rps6kb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103741760 (Rps6kb1)
   05212 Pancreatic cancer
    103741760 (Rps6kb1)
   05225 Hepatocellular carcinoma
    103741760 (Rps6kb1)
   05226 Gastric cancer
    103741760 (Rps6kb1)
   05221 Acute myeloid leukemia
    103741760 (Rps6kb1)
   05224 Breast cancer
    103741760 (Rps6kb1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103741760 (Rps6kb1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103741760 (Rps6kb1)
   05163 Human cytomegalovirus infection
    103741760 (Rps6kb1)
   05165 Human papillomavirus infection
    103741760 (Rps6kb1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103741760 (Rps6kb1)
   01522 Endocrine resistance
    103741760 (Rps6kb1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103741760 (Rps6kb1)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   103741760 (Rps6kb1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103741760
NCBI-ProteinID: XP_008840881
LinkDB
Position
Un
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERSILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttctacccagcgcctgacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcaggctct
gaggatgagctggaggaggggggtcagttaaacgaaagcatggaccatgggggcgttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatatcagaaactagtgtgaac
cgagggccagaaaaaatcagaccagaatgctttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactggaaagatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagacacagctcataca
aaggcagagcggagtattctggaggaagtaaagcatcccttcattgtggacttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagtggaggagaacta
tttatgcagttagaaagagagggaatatttatggaagacacggcttgtttttacttggct
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaacatcatgcttaatcaccaaggtcacgtgaaattaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgcgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacctccattcaccggggagaacagaaagaaa
acaattgacaaaatcctcaaatgtaaacttaatttgcctccctacctcacacaagaagct
agagatctgcttaaaaagctgctgaagagaaatgctgcttctcgacttggagctggtcct
ggggatgctggagaagtccaagctcatccatttttcagacacattaactgggaagaactc
ctggctcggaaggtggagcccccctttaaaccgctactgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgccagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agcgtgaaagaaaagttttcctttgaaccaaaaatccggtcacctcgaagatttattggt
agcccacgaacaccagtcagcccagtcaaattctctcctggggatttctggggaagaggt
gcttcagccagcacggcaaatcctcagacacctgtggagtacccaatggaaacaagcgga
atagagcagatggatgtgactatgagtggggaagcgtcagcaccacttccaatccgacag
ccgaactccgggccatacaaaaaacaagcttttcctatgatctccaaacggccagagcac
ctgcgtatgaatctatga

DBGET integrated database retrieval system