KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725694
Entry
103725694         CDS       T03372                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2-like
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00562  Inositol phosphate metabolism
ngi01100  Metabolic pathways
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04020  Calcium signaling pathway
ngi04062  Chemokine signaling pathway
ngi04064  NF-kappa B signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04072  Phospholipase D signaling pathway
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04380  Osteoclast differentiation
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04625  C-type lectin receptor signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04670  Leukocyte transendothelial migration
ngi04722  Neurotrophin signaling pathway
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04919  Thyroid hormone signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05223  Non-small cell lung cancer
ngi05225  Hepatocellular carcinoma
Module
ngi_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103725694
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103725694
   04014 Ras signaling pathway
    103725694
   04370 VEGF signaling pathway
    103725694
   04064 NF-kappa B signaling pathway
    103725694
   04066 HIF-1 signaling pathway
    103725694
   04020 Calcium signaling pathway
    103725694
   04070 Phosphatidylinositol signaling system
    103725694
   04072 Phospholipase D signaling pathway
    103725694
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103725694
   04613 Neutrophil extracellular trap formation
    103725694
   04625 C-type lectin receptor signaling pathway
    103725694
   04650 Natural killer cell mediated cytotoxicity
    103725694
   04662 B cell receptor signaling pathway
    103725694
   04664 Fc epsilon RI signaling pathway
    103725694
   04666 Fc gamma R-mediated phagocytosis
    103725694
   04670 Leukocyte transendothelial migration
    103725694
   04062 Chemokine signaling pathway
    103725694
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    103725694
   04919 Thyroid hormone signaling pathway
    103725694
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103725694
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103725694
  09158 Development and regeneration
   04360 Axon guidance
    103725694
   04380 Osteoclast differentiation
    103725694
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103725694
   05206 MicroRNAs in cancer
    103725694
   05205 Proteoglycans in cancer
    103725694
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103725694
   05214 Glioma
    103725694
   05223 Non-small cell lung cancer
    103725694
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103725694
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103725694
   05171 Coronavirus disease - COVID-19
    103725694
   05167 Kaposi sarcoma-associated herpesvirus infection
    103725694
   05169 Epstein-Barr virus infection
    103725694
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103725694
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103725694
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103725694
Membrane trafficking [BR:ngi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103725694
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103725694
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y SH2 PH PH_12 C2 EF-hand_like
Other DBs
NCBI-GeneID: 103725694
NCBI-ProteinID: XP_017651059
LinkDB
Position
Un
AA seq 920 aa
MKYRAIVVSKRMTPFGKDQNSVSSEIMPAERIIEDNPLGSLCRGILDLNTYNVVKAAQGK
NQKPFIFILEPKKQGDPPMEFATDRVEELFEWFQSIREITWKMDTKENNMRYWEKNQSIA
IELSGLVVYCKPTSKTKDHLENPDFREIRSFVEMKANSIVRQKLGDLLWYNHKGLTRVYP
KGQRVDSSNYDPFRLWLCGSQMVALNFQTADKYMQMNHALFSLNGRTGYVLQPESMRSDK
YDPMSPESQRKILMTLTVKVLGARHLPKLGRSIACPFVEVEICGAEYDNNKFKTTVVTTP
SRSQHALTLPCADHHAKVGLWSEESAAGVWIHSEMDIMEIKEICPGRSCKDFERAKAVHH
QEDCCFTILYGTQFVLNTLSLATDSKEDAVKWLSGLKILHQEAMSASTPTMIESWLRKQI
YSVDQTRRNRSCCCCGNTENQKIHLFRETLETFSKEPLAEAPQKEQLTQEICAHKDDLSF
EQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASAVYLQDFQRFLLHEQQELWA
QDLSKVRERMTKFIDDTMRETSEPFLFVDEFLTYLFSXENSIWDEKYNVVDMQDMNNPLY
LTRDQLRSESSIEAYIRCLRAGCHCIELGCLDGPDGKPIIYHGWTRTTKIKFDDVVQAIR
DHAFVSSSFPVILSIEEHCSVEQQRHMAKVFKEVLGDLLLTKPTEASADQLPSPCQLREK
IIIKKWTRHYCAIADAKLSFSDDIEQNVEEELVQDTPPTELHFGKKWFHKKVERRTSAEK
LLQEYCAEMGAKDGTFLVQESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTMKYYLTDNT
MFNSIYALIQHYRETHLHCAEFELRLTDPVPNPNPHESKPWYYDRLSRGEAEDMLMWIPR
DGAFLIRKREGTDSYVITFR
NT seq 2763 nt   +upstreamnt  +downstreamnt
atgaagtaccgagctattgttgtaagcaagagaatgacgccctttggaaaggaccagaac
agtgtcagttccgagatcatgccggccgaaagaattattgaagacaacccccttgggtct
ctctgcagaggtattttggacctcaatacctacaatgtcgtgaaggccgctcaggggaaa
aaccagaaaccattcatcttcatcctggagcccaagaagcagggggaccctcccatggag
ttcgccacagaccgtgtggaggagctgttcgaatggtttcagagcatccgggagatcacg
tggaagatggatacaaaggagaacaacatgaggtactgggaaaagaaccagtccatcgcc
attgagctctccggcctggttgtctactgcaagccaaccagcaaaaccaaggaccatttg
gaaaaccccgacttccgagaaatccgctccttcgtagagatgaaggccaacagcattgtc
agacagaagctgggagatctcctgtggtacaatcacaagggcctgacccgagtctaccca
aagggacagagagttgactcttcaaactatgaccccttccggctatggctctgtggctcc
cagatggtagcgctcaatttccagactgcagacaagtacatgcaaatgaaccatgcgttg
ttttcgctcaatgggcggacgggctacgtcctgcagcccgagagcatgcggtctgacaag
tacgacccgatgtccccagagtcgcaaaggaagatcttgatgactctcaccgtcaaggtt
cttggcgcacgccacctccccaaacttgggcggagtattgcctgtccctttgtagaggtg
gaaatctgtggagccgaatatgacaacaacaagtttaagacaacggttgtgacaactcct
tcaagatcccaacatgcgctgaccctgccatgtgccgaccaccatgccaaggtggggctg
tggtctgaggaaagtgctgcaggtgtttggattcactctgagatggacatcatggagata
aaggaaatctgcccagggaggagctgtaaggacttcgagcgtgccaaggccgtccatcac
caagaggactgctgcttcaccatcctctatggcacccagttcgtcctcaacacgctcagt
ctggcaaccgactcgaaggaggacgcagtgaagtggttgtctggcttgaagatcctccac
caggaagccatgagcgcatctactcccaccatgatcgagagttggctgagaaagcagatt
tattcagtggatcaaaccagaagaaacaggtcctgctgctgctgtggcaacacggaaaat
cagaaaatccaccttttccgagagaccctagagacattttcaaaagaacctttggccgaa
gcaccccagaaagagcagctgacacaagaaatctgtgcacacaaagacgacctcagtttt
gaacagttccatctcttctataaaaaacttatgtttgagcagcaaaaatcgatactcgac
gaattcaagaaggactcctctgtgttcatcctggggaacacagaccggccagatgcatct
gctgtctacctgcaggacttccagaggtttctcttacatgaacagcaggagctttgggct
caggatttaagcaaagtccgggagcggatgaccaagtttattgacgatacgatgagggaa
acctcagagcccttcttgtttgtggatgagttcctcacatacctgttctcatgagaaaac
agcatctgggatgagaaatacaacgtggtggacatgcaggacatgaacaaccccttgtac
ctcaccagggaccagctgcgcagcgagtcgtccatagaggcgtacatccgctgcctgcgt
gccggctgccattgcattgaattgggctgcttggatgggcctgatggaaaacccatcatc
taccacggctggacgcggaccaccaagatcaagtttgatgatgttgtgcaagccatccgg
gaccatgcctttgtttcctccagcttccctgtgatcctgtccatcgaggagcactgcagc
gtcgagcagcagcgccacatggctaaggtgttcaaggaggtgttgggagatctgctgctg
acaaagcccacggaggccagtgccgaccagctgccctcaccctgccagctgcgagagaag
atcatcatcaagaaatggactcgccactactgtgccattgctgacgccaagctgtccttt
agcgatgacattgaacagaatgtggaggaggagctggttcaggatactccccctacagag
ctgcattttgggaagaagtggttccataagaaggtggagaggaggaccagcgctgaaaaa
ctcctgcaggagtactgtgccgagatgggggccaaggacggcaccttcctggtgcaggag
agcgagaccttccccaacgactacaccttgtctttctggcggtcaggccgtgtgcagcac
tgcaggatccgctccaccatggaaggcggaaccatgaagtactacctgacagacaacacc
atgttcaacagcatctacgccctcattcagcactaccgggaaacacacctgcattgtgcg
gagttcgagcttcggcttaccgacccagtgcccaaccccaacccgcatgagtctaagcca
tggtactacgacaggctgagccggggggaggcagaggacatgctgatgtggatccccaga
gatggagccttcctcatccggaagcgggaggggactgactcctacgtcatcaccttcagg
tag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747244
Entry
103747244         CDS       T03372                                 

Gene name
Plcg1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00562  Inositol phosphate metabolism
ngi01100  Metabolic pathways
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04062  Chemokine signaling pathway
ngi04064  NF-kappa B signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04072  Phospholipase D signaling pathway
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04613  Neutrophil extracellular trap formation
ngi04650  Natural killer cell mediated cytotoxicity
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04670  Leukocyte transendothelial migration
ngi04722  Neurotrophin signaling pathway
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04919  Thyroid hormone signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi05012  Parkinson disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05135  Yersinia infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05223  Non-small cell lung cancer
ngi05225  Hepatocellular carcinoma
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
ngi_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103747244 (Plcg1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103747244 (Plcg1)
   04014 Ras signaling pathway
    103747244 (Plcg1)
   04015 Rap1 signaling pathway
    103747244 (Plcg1)
   04370 VEGF signaling pathway
    103747244 (Plcg1)
   04064 NF-kappa B signaling pathway
    103747244 (Plcg1)
   04066 HIF-1 signaling pathway
    103747244 (Plcg1)
   04020 Calcium signaling pathway
    103747244 (Plcg1)
   04070 Phosphatidylinositol signaling system
    103747244 (Plcg1)
   04072 Phospholipase D signaling pathway
    103747244 (Plcg1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103747244 (Plcg1)
   04650 Natural killer cell mediated cytotoxicity
    103747244 (Plcg1)
   04660 T cell receptor signaling pathway
    103747244 (Plcg1)
   04658 Th1 and Th2 cell differentiation
    103747244 (Plcg1)
   04659 Th17 cell differentiation
    103747244 (Plcg1)
   04664 Fc epsilon RI signaling pathway
    103747244 (Plcg1)
   04666 Fc gamma R-mediated phagocytosis
    103747244 (Plcg1)
   04670 Leukocyte transendothelial migration
    103747244 (Plcg1)
   04062 Chemokine signaling pathway
    103747244 (Plcg1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    103747244 (Plcg1)
   04919 Thyroid hormone signaling pathway
    103747244 (Plcg1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103747244 (Plcg1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103747244 (Plcg1)
  09158 Development and regeneration
   04360 Axon guidance
    103747244 (Plcg1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747244 (Plcg1)
   05206 MicroRNAs in cancer
    103747244 (Plcg1)
   05205 Proteoglycans in cancer
    103747244 (Plcg1)
   05231 Choline metabolism in cancer
    103747244 (Plcg1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103747244 (Plcg1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103747244 (Plcg1)
   05214 Glioma
    103747244 (Plcg1)
   05223 Non-small cell lung cancer
    103747244 (Plcg1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103747244 (Plcg1)
   05022 Pathways of neurodegeneration - multiple diseases
    103747244 (Plcg1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103747244 (Plcg1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103747244 (Plcg1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103747244 (Plcg1)
   05171 Coronavirus disease - COVID-19
    103747244 (Plcg1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103747244 (Plcg1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103747244 (Plcg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103747244 (Plcg1)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103747244 (Plcg1)
Membrane trafficking [BR:ngi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103747244 (Plcg1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103747244 (Plcg1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 103747244
NCBI-ProteinID: XP_008847808
LinkDB
Position
Un
AA seq 1291 aa
MAGATTPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRT
GERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLNTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLSRAQAEHMLMRVPRDGAFLVRKRNEANSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLW
FPSNYVEEMISPAALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCVICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFHINNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDVFPAKQENGDLSPFGGTSLRERVSDASSQLFHGRAREGSFEARYQQPFED
FRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3876 nt   +upstreamnt  +downstreamnt
atggcgggcgccacgaccccctgcgccaatggctgcgggcccggcgcgccctccgatgcc
gaggtgttgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcggccggaacggaagaccttccaggtcaaactggagacgcgccagatc
acgtggagccgcggcgccgacaagatcgagggggccattgatattcgtgaaatcaaagag
atccgcccagggaagacttctcgagactttgaccgctaccaagaagaccctgctttccgg
ccagaccagtcacactgctttgtcatcctctatggaatggaattccgcctgaagacccta
agcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggcttaacttggctg
atggaggacacattgcaggcagccacacccctgcagattgagaggtggctccggaaacag
ttctactcagtggaccggaaccgtgaggatcgtatatcagccaaggacctgaagaacatg
ttgtcacaagtcaattatcgggtccccaacatgcgcttcctccgagaacggctgacggac
ctggaacagcgcagcggggacatcacctatggacagtttgctcagctgtaccgcagcctc
atgtacagcgcacagaagacgatggacctccccttcttggaagccagcactttgagaact
ggggagcggccagagctctgtcgggtatctcttcccgagttccagcagtttctccttgag
taccagggggaactatgggcagttgaccgccttcaggtgcaggaattcatgctcagtttc
ctcagagaccccttgcgagagattgaggaaccatacttctttttggatgagtttgttacc
tttctgttctccaaagagaacagtgtgtggaactcccagctggatgccgtgtgcccagac
accatgaacaaccctctctcccactactggatctcgtcctcgcataacacgtacctgact
ggggaccagttctccagcgaatcctcactggaagcttatgctcgctgcctgaggatgggc
tgtcgctgcattgagttggattgctgggacggcccagatgggatgccagtcatttaccac
gggcatacccttaccaccaagatcaagttctcagatgtcctgaacacaatcaaggagcat
gctttcgtggcctcagagtacccagtcatcctgtccattgaggaccactgcagcattgcc
cagcagaggaacatggcccagtacttcaagaaggtgcttggggacacactcctcaccaag
cctgtggacattgccgctgatgggctcccctcacccaaccagctcaaaaggaagattctt
attaagcacaagaagctggccgagggcagtgcctatgaggaagtgcctacttctgtgatg
tactctgagaatgacatcagcaactccatcaagaatggcatcctctacctggaagaccct
gtgaaccatgaatggtatccccactacttcgttctgaccagcagcaagatctactactct
gaggagacaagcagtgaccagggcaatgaggatgaagaggagccaaaggaggccagtggg
agcacagaactgcactccaatgagaagtggttccatgggaagctcggggctggacgagat
gggcggcacattgctgagcgcctcctcaccgagtactgcattgagaccggggctcctgat
ggctccttcctagtgcgagaaagcgagacctttgtgggcgactacacactgtctttctgg
cggaatgggaaagtccagcactgccgtatccactctcgacaggatgccggtacccccaag
ttcttcttgacagataaccttgtctttgactccctctatgacctcatcacacactatcag
caggtgccacttcgctgcaatgagtttgagatgcgcctttcagagcctgttccacagaca
aatgcccacgagagcaaagagtggtaccatgcaagcctgtcgagagctcaggctgaacac
atgctgatgcgtgtaccacgtgatggggctttcctggtgcggaaacggaatgaggccaac
tcatacgctatctccttccgggctgagggaaagataaagcactgccgagtccagcaggag
ggccaaactgtgatgctggggaactccgagttcgacagccttgtcgacctcatcagctac
tacgagaagcaccccctgtaccgcaaaatgaagttgcgctaccccatcaacgaggaggca
ctggagaagattggcacagcagagcctgattacggggcactgtatgaaggccgcaaccct
ggcttctatgtggaggcaaaccccatgccaactttcaagtgtgcagtcaaagccctcttt
gactacaaggcccagagagaggatgagctgaccttcaccaagagtgccatcatccagaat
gtagagaagcaagatggtggctggtggcgaggggactatggtgggaagaagcagctgtgg
ttcccttcaaactacgtggaagagatgatcagcccagcagccctggagccagagagggag
cacctggacgagaacagccccctgggggacttgctgcggggggtcttggatgtgccagcc
tgtcagattgccattcgtcctgagggcaagaacaaccggctgttcgtgttctccatcagc
atggcatcagtggctcactggtccctagatgttgcagctgactcgcaggaggagttgcag
gactgggtgaaaaagatccgggaagtggcccagactgcagatgccaggcttactgagggg
aagatgatggaacggaggaagaagatcgccttggagctttctgagctcgtggtctactgc
cggcctgttccgtttgatgaagagaagattggcacagaacgagcctgttaccgggacatg
tcatcctttccggaaaccaaagctgagaagtacgtgaacaaggccaaaggcaagaagttc
ctccagtacaatcgcctgcagctctcccgcatctaccccaagggccagcgactggactcc
tccaattacgatcctctgcccatgtggatctgtggcagtcagcttgtggctctcaatttc
cagaccccagacaagcctatgcagatgaaccaggccctcttcatggccggtggacactgt
ggctacgtgctgcagccaagcaccatgagagatgaagcctttgacccctttgacaagagc
agcctccgaggactggagccctgtgtcatctgcattgaggtgctgggggcccggcatctg
ccaaagaatggccgaggcattgtgtgtccttttgtggagattgaggtggctggagcagag
tatgacagcaccaagcaaaaaacagagtttgtagtggacaatgggctgaaccctgtgtgg
ccagccaagcccttccacttccatatcaataaccctgaatttgccttcctgcgctttgtg
gtgtatgaagaagacatgtttagtgaccagaacttcttagctcaggctactttcccagtg
aaaggcctgaagacaggctatagagcagtgcctctgaaaaacaactacagtgaagacctg
gagttggcctccctgctcatcaagattgacgttttccctgccaagcaggagaacggtgac
ctcagtccctttggtggtacatccctgcgggaacgggtctctgatgcctcaagccagctg
tttcatgggcgggctcgggaaggctcctttgaagcccgctatcaacagccatttgaagac
ttccgcatctcccaggagcatctcgcagatcattttgacagtcgagaacgaagggcccca
agaaggactcgggtcaacggagacaaccgcctctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748739
Entry
103748739         CDS       T03372                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00562  Inositol phosphate metabolism
ngi01100  Metabolic pathways
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04020  Calcium signaling pathway
ngi04062  Chemokine signaling pathway
ngi04064  NF-kappa B signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04072  Phospholipase D signaling pathway
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04380  Osteoclast differentiation
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04625  C-type lectin receptor signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04670  Leukocyte transendothelial migration
ngi04722  Neurotrophin signaling pathway
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04919  Thyroid hormone signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05223  Non-small cell lung cancer
ngi05225  Hepatocellular carcinoma
Module
ngi_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103748739
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103748739
   04014 Ras signaling pathway
    103748739
   04370 VEGF signaling pathway
    103748739
   04064 NF-kappa B signaling pathway
    103748739
   04066 HIF-1 signaling pathway
    103748739
   04020 Calcium signaling pathway
    103748739
   04070 Phosphatidylinositol signaling system
    103748739
   04072 Phospholipase D signaling pathway
    103748739
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103748739
   04613 Neutrophil extracellular trap formation
    103748739
   04625 C-type lectin receptor signaling pathway
    103748739
   04650 Natural killer cell mediated cytotoxicity
    103748739
   04662 B cell receptor signaling pathway
    103748739
   04664 Fc epsilon RI signaling pathway
    103748739
   04666 Fc gamma R-mediated phagocytosis
    103748739
   04670 Leukocyte transendothelial migration
    103748739
   04062 Chemokine signaling pathway
    103748739
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    103748739
   04919 Thyroid hormone signaling pathway
    103748739
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103748739
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103748739
  09158 Development and regeneration
   04360 Axon guidance
    103748739
   04380 Osteoclast differentiation
    103748739
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103748739
   05206 MicroRNAs in cancer
    103748739
   05205 Proteoglycans in cancer
    103748739
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103748739
   05214 Glioma
    103748739
   05223 Non-small cell lung cancer
    103748739
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103748739
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103748739
   05171 Coronavirus disease - COVID-19
    103748739
   05167 Kaposi sarcoma-associated herpesvirus infection
    103748739
   05169 Epstein-Barr virus infection
    103748739
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103748739
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103748739
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103748739
Membrane trafficking [BR:ngi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103748739
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103748739
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 SH3_2 PH GDPD
Other DBs
NCBI-GeneID: 103748739
NCBI-ProteinID: XP_017658289
LinkDB
Position
Un
AA seq 1054 aa
ILDEFKKDSSVFILGALQHYTGSGLQLLRRPQDLVWMRVQYQLLELWAQDLNKVRERMTK
FIDDTMRETSEPFLFVDEFLTYLFSRENSIWDEKYNVVDMQDMNNPLSHYWISSSHNTYL
TGDQLRSESSTEAYIRCLRAGCRCIELDCWDGPDGKPIIYHGWTRTTKIKFDDVVQAIRD
HAFVSSSFPVILSIEEHCSVEQQRHMAKVFKEVLGDLLLTKPTEASADQLPSPCQLREKI
IIKHKKLGPRGDVDVNMEDKKDEHKTQGELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQ
NVEEELVQDTPPTELHFGEKWFHKKVERRTSAEKLLQEYCAETGAKDGTFLVRESETFPN
DYTLSFWRSGRVQHCRIRSTMEGGTMKYYLTDNTMFNSIYALIQHYRETHLHCAEFELRL
TDPVPNPNPHESKPWYYDRLSRGEAEDMLMRIPRDGAFLIRKREGTDSYAITFRAKGKVK
HCRINRDGRHFVLGTSAYFESLVELVNYYEKHALYRKMRLRYPVTPELLERYNMERDINS
LYDVSRMYVDPSEINPSMPQRTVKALYDYKAKRSDELSFCRGALIHNVSKEPGGWWKGDY
GTRIQQYFPSNYVEDISAGDVEELEKQIIEDNPLGSLCRGILDLNTYNVVKAPQGKNQKP
FVFILEPKKQGDPPVEFATDRVEELFEWFQSIREITWKMDTKENNMRYWEKNQSIAIELS
DLVVYCKPTSKTKDHLENPDFREIRSFVETKADSIVRQKPGDLLRYNHKGLTRVYPKGQR
VDSSNYDPFRLWLCGSQMVALNFQTADKYMQMNHALFSLNGQTGYILQPESMRSDKYDPM
SPESQRKILMTLTVKVLGARHLPKLGRSIACPFVEVEICGAKYDNNKFKTTVVNDNGLSP
VWAPTQEKVTFEIYDPNLAFLRFVVYEEDMFSDPNFLAHATYPIKGIKSGFRSVPLKNGY
SEDIELASLLVFCEMRPVLESEEELYSSCRQLRRRQEELNNQLFLYDTHQNLRGANRDAL
VKEFNVNENQLQLYQEKCNRRLREKRVSNSKFYS
NT seq 3165 nt   +upstreamnt  +downstreamnt
atactcgacgaattcaagaaggattcctctgtgttcatcctgggagccctccagcactac
acaggctctgggctgcagcttctgaggaggccccaggacctggtctggatgagggtccag
tatcagcttctagagctttgggctcaggatttaaacaaagtccgggagcggatgaccaag
tttattgacgatacgatgagggaaacctcagagcccttcttgtttgtggatgagttcctc
acatacctgttctcacgagaaaacagcatctgggatgagaaatacaacgtggtggacatg
caggacatgaacaaccccttgtcacattactggatctcttcctcccacaacacgtacctc
actggggaccagctgcgcagcgagtcgtccacagaggcgtacatccgctgcctgcgtgcc
ggctgccgttgcattgaattggactgctgggatgggcctgatggaaaacccatcatctac
cacggctggacgcggaccaccaagatcaagtttgatgatgtcgtgcaagccatccgggac
catgcctttgtttcctccagcttccctgtgatcctgtccatcgaggagcactgcagcgtc
gagcagcagcgccacatggctaaggtgttcaaggaggtgttgggagatctgctgctgaca
aagcccacggaggccagtgccgaccagctgccctcaccctgccagctgcgagagaagatc
atcatcaagcataagaagctgggtccccgaggcgatgttgatgtcaacatggaggacaag
aaggatgaacacaagactcagggcgagctgtacatgtgggactccatcgaccagaaatgg
actcgccactactgtgccattgctgacgccaagctgtcctttagcgatgacattgaacag
aatgtggaggaggagctggttcaggacactccccctacagagctgcattttggggagaag
tggttccataagaaggtggagaggaggaccagcgctgaaaaactcctgcaggagtactgt
gccgagacgggggccaaggacggcaccttcctggtgcgggagagcgagaccttccccaac
gactacaccttgtctttctggcggtcaggccgtgtgcagcactgcaggatccgctccacc
atggaaggcggaaccatgaagtactacctgacggacaacaccatgttcaacagcatctac
gccctcattcagcactaccgggaaacacacctgcattgtgcggagttcgagcttcggctt
accgacccagtgcccaaccccaacccgcatgagtctaagccatggtactatgacaggctg
agccggggggaggcagaggacatgctgatgcggatccccagagatggagccttcctcatc
cgtaagcgggaggggaccgactcctacgccatcaccttcagggccaagggcaaggtgaaa
cactgtcggattaaccgggatggccggcactttgtactggggacctctgcctactttgag
agcctcgtggagcttgtcaactactatgagaagcacgcgctctatcggaagatgaggctg
cgctacccggtgacccccgagctcctggagcgctacaatatggaaagagacatcaactct
ctttatgatgtcagcaggatgtatgtggacccgagtgagatcaacccttccatgcctcag
aggactgtgaaagcactctatgactacaaagccaaacgcagcgatgaactgagcttctgc
cggggtgccctcattcacaatgtctccaaggagcctgggggctggtggaaaggggactac
gggacccgaatccagcagtactttccatccaactacgtggaggacatttcagcaggtgat
gttgaagagttagagaagcagattattgaagacaacccccttgggtctctctgcagaggt
attttggacctcaatacctacaatgtcgtgaaggcccctcaggggaaaaaccagaaacca
ttcgtcttcatcctggagcccaagaagcagggggaccctcccgtggagttcgccacagac
cgtgtggaggagctgttcgaatggtttcagagcatccgggagatcacgtggaagatggat
acgaaggagaacaacatgaggtactgggaaaagaaccagtccatcgccattgagctctcc
gacctggttgtctactgcaagccaaccagcaaaaccaaggaccatttggaaaaccccgac
ttccgagaaatccgctccttcgtagagacgaaggccgacagcattgtcagacagaagccg
ggagatctcctgcggtacaatcacaagggcctgacccgagtctacccgaagggacagaga
gttgactcttcaaactatgaccccttccggctatggctctgcggctcccagatggtggcg
ctcaatttccagactgcagacaagtacatgcaaatgaaccatgcgttgttttcgctcaat
gggcagacgggctacatcctgcagcccgagagcatgcggtctgacaagtacgacccgatg
tccccagagtcgcaaaggaagatcttgatgactctcaccgtcaaggttcttggcgcacgc
cacctccccaaacttgggcggagtattgcctgtccctttgtagaggtggaaatctgtgga
gccaaatatgacaacaacaagtttaagacaacggttgtgaatgacaatggcctcagccct
gtctgggcaccaacacaggagaaggtgacctttgaaatttatgacccaaaccttgcgttt
ctgcgctttgtggtctatgaggaagacatgttcagtgaccccaacttcctggctcatgcc
acgtatcccattaaaggcatcaaatcagggttccgatcggtccccctgaagaacgggtac
agtgaagacattgagctggcttctctgctggttttctgtgagatgcggccagtcctggag
agcgaagaggaactctattcctcatgccgccagctacggaggcgacaagaggagctaaac
aaccagctcttcctgtacgacacacaccagaaccttcgaggcgccaaccgtgatgcccta
gtcaaggaattcaacgttaacgagaatcagctccagctttatcaggagaagtgcaaccgg
aggttgagagagaagagagttagcaacagcaagttctactcctag

DBGET integrated database retrieval system