KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725749
Entry
103725749         CDS       T03372                                 

Gene name
Socs5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103725749 (Socs5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103725749 (Socs5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103725749 (Socs5)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     103725749 (Socs5)
SSDB
Motif
Pfam: SOCS SH2 SOCS_box
Other DBs
NCBI-GeneID: 103725749
NCBI-ProteinID: XP_008821278
LinkDB
Position
Un
AA seq 536 aa
MDKVGKMWNNFKYRCQNLFSHEGGNHSDNVDMNSNRCLSVKEKSISLGESSPQQQSSPLR
ENVALHLGLSPSKSFSRRNQNCATEIPQIVEISIEKDSDSGIAPGARLGRRDSYSRHAPW
GGKKKHSCSTKTQSSLDTEKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPVRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDSSAVPQTNCDSEEDTTTLCLQSRRQKQRQVSGDSHAHISRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtggggaaaatgtggaataacttcaaatacaggtgccagaatctcttcagt
catgagggaggaaaccacagtgacaatgtggacatgaactccaacagatgtttgtctgtc
aaagagaaaagcatcagtctgggagagtcctctcctcagcaacagagtagtcccttaaga
gaaaatgttgccttacacctgggactcagcccttcaaagagtttttcaagaagaaaccaa
aattgtgccactgaaatccctcagattgttgaaataagcattgagaaggacagtgactcg
ggtatcgccccaggtgcaaggcttggacggagagattcctattctcgacatgccccttgg
ggagggaagaagaaacattcctgttccacaaagacccaaagttcactggatactgagaaa
aagtttggtcgaactcgaagtggacttcagagacgagaacggcgctatggagtcagctct
gtgcacgacatggacagcgtatccagcaggaccgtcgggagccgctctctgaggcagagg
ctgcaggacacagtgggcttgtgtttcccggtgagaacatacagcaagcagtcaaagccc
cttttttccaacaaaagaaaaatacatctttctgaattaatgctggagaaatgccccttt
cctgctggctcagatttagcccaaaaatggcatttgattaaacagcatacggctcctgtg
agcccacactcaacattttttgatacatttgatccatcattggtatctacagaagatgaa
gaagataggcttcgagagaggaggcggcttagtatcgaggaaggggtggatccccctccc
aatgcacaaatacatacatttgaagctactgcacaggttaatccattatataaactgggc
ccaaagttagcccctggaatgaccgaaataagtggggacagttctgcagttccacaaacg
aattgtgactcagaagaagatacaaccaccctgtgtctacagtcacggaggcagaagcag
cgccaggtgtctggagacagccacgcgcacatcagcagacagggagcttggaaagtccat
acgcagatcgattacatacactgccttgtgcccgacttgcttcaaatcactgggaacccc
tgttactggggcgtgatggaccgttatgaagcggaagcccttctcgaagggaagcctgaa
ggcacatttttgctcagggactctgcacaggaggactacctcttctctgtgagcttccgg
cgctacaacagatccctgcatgcccgaatcgaacagtggaaccacaacttcagtttcgat
gcccacgacccgtgtgtgtttcactcctccactgtcactggacttctagagcattataaa
gatcccagttcttgcatgttttttgaaccgttgcttactatatcactgaacaggactttt
cctttcagcctacagtatatctgccgcgcagtgatctgcaggtgcactacgtatgatgga
attgatgggctccctctcccatcaatgttacaggattttttaaaagagtatcattataaa
caaaaagttagagttcgctggttagagcgagaaccagtcaaggcaaagtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726290
Entry
103726290         CDS       T03372                                 

Gene name
Socs2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04630  JAK-STAT signaling pathway
ngi04910  Insulin signaling pathway
ngi04917  Prolactin signaling pathway
ngi04930  Type II diabetes mellitus
ngi04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103726290 (Socs2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103726290 (Socs2)
   04917 Prolactin signaling pathway
    103726290 (Socs2)
   04935 Growth hormone synthesis, secretion and action
    103726290 (Socs2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103726290 (Socs2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103726290 (Socs2)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     103726290 (Socs2)
SSDB
Motif
Pfam: SH2 SOCS_box SH2_2 Condensation
Other DBs
NCBI-GeneID: 103726290
NCBI-ProteinID: XP_008821989
LinkDB
Position
Un
AA seq 198 aa
MTLRCLESSGNGADRTRSQWGTAGSAEEPSPEAARLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLLRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKQKGPEAPRNGTVHLYLTKPLYTSAPSLQHFCRLTINKCTGTIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctggagtcctccggtaatggcgcggacaggacgcggagccagtgg
gggaccgcggggtcggcggaggagccgtccccggaggcggcgcggctggccaaggccctg
cgggaactcagtcagacaggatggtactggggaagtatgactgttaacgaagccaaagaa
aaattaaaagaggcgccagaaggaactttcttgcttagagatagttcacattcagactac
ctactaacaatatctgttaagacgtcagcaggaccgactaatcttcggattgagtaccaa
gatgggaaattcagattggattctatcatatgtgtcaagtccaagcttaaacagtttgac
agtgtggttcatctgattgactactatgttcagatgtgcaaggataaacagaagggccca
gaagcccctcggaatggaactgttcacctgtatctgaccaaaccgctgtatacatcagca
ccatccctacagcatttctgtcgactcaccattaacaaatgtaccggtaccatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727130
Entry
103727130         CDS       T03372                                 

Gene name
Socs6
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103727130 (Socs6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103727130 (Socs6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103727130 (Socs6)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     103727130 (Socs6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 103727130
NCBI-ProteinID: XP_017651559
LinkDB
Position
Un
AA seq 541 aa
MKKISLKTFRKSFNLSKSKDETEFMVVQPQSLAGDFGKDDSLFGSCYGKDMASCDVSSED
EKGKNRSKSESLMGTLKRRLSAKQKAKGKGGTASTDEDAFSSASAPGGLKDVRAQRPIRS
TSLRSHHYSPTPWPLRPTSSEETCIKMEMRVKALVHAASPGPVNGVRKELRELQPRELRE
LQPRELRDLQLEPRPEPHCSPSSPGDLRLHLEEHVPVVIGLMSQDYLQYTVPLDDGMCAL
EGPRSCCLDTSSPMEVSAVPTPGTGGTFAEDDSQLDQDLVIAPEILVDPSMNGLLIGTTG
VMLQSPRAGPDDVPPLSPLLPPMQNNPIQRNFSGLSGTDAHVAESVRCHLNFDPNSAPGV
ARVYDSVQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDD
RYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSR
SRLPGSATYPVRLTHPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKH
Y
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgaagaaaattagtctgaaaacctttcgaaaatccttcaacctaagtaaaagcaaagac
gaaaccgagttcatggtggttcagccccagtcccttgccggtgacttcgggaaagatgac
tccttgttcgggagctgctacggtaaagacatggccagctgcgacgtcagcagtgaggat
gagaaagggaagaacaggtccaagagcgagagcctgatgggcaccctgaagaggcggctg
tcggccaaacagaaggccaagggtaagggcggcactgcgtccacagatgaagacgccttc
tcgtcggcctctgcgccaggtggcctcaaggacgtgcgggcccagcgacccatccgctcc
acgtcactgcgcagccaccactacagccccacaccgtggcccctgcgacccacaagctca
gaggagacgtgcatcaagatggagatgcgcgtgaaggcgctggtgcatgctgccagcccg
ggcccggtcaacggtgtgcgcaaggaactgcgggagctgcagcccagggagttgcgggag
ctgcagcccagggagctgcgcgacctgcagctcgagccccgcccagagccccactgcagc
cctagctcgcccggggacctgcgcctccatctggaggaacacgtgcctgtagttatcgga
ctcatgtctcaggactatcttcagtacaccgtgcctttagacgacgggatgtgtgctctg
gaagggccgcgcagctgctgcctggacacgtcctcacccatggaggtgtccgccgtgccc
acgccggggacaggtggcacctttgcggaggacgacagtcagttggaccaggacctggtc
attgcccctgagatcctcgtggatccatcaatgaatggcttgttgattggcaccacggga
gtcatgttgcagagccccagagcaggtcccgacgacgtccctcccctctcaccgttgcta
cctccaatgcagaataaccccatccaaaggaacttcagtggtctctcgggcacggatgcc
cacgtggctgaaagcgtgcgctgtcatttgaattttgatcccaactctgcacccggggtt
gcgagagtttatgactccgttcaaagtagtggtcccatggttgtgacaagccttacggag
gagctgaagaagcttgcgaaacaagggtggtactggggcccgatcacacgctgggaggct
gaggggaagctggcaaacgtgccagatggttcttttcttgttcgggatagctctgatgac
cgatatcttttgagcctgagctttcgctcccatgggaaaacacttcacactagaatcgag
cactccaatggtaggtttagcttttacgaacagccagatgtggaagggcatacgtctata
gttgacttaattgagcattcaatcagggactctgagaacggagcgttttgttattcaagg
tctcggttgcctggatctgcaacctacccggtcagactgacccatccggtgtcacggttc
atgcaggtgcgttctttgcagtacctttgtcgctttgttatacgtcagtataccagaata
gacttaattcagaaactgcctttgccaaacaaaatgaaggattatttacaggagaagcac
tactga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731577
Entry
103731577         CDS       T03372                                 

Gene name
Socs1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04120  Ubiquitin mediated proteolysis
ngi04380  Osteoclast differentiation
ngi04630  JAK-STAT signaling pathway
ngi04910  Insulin signaling pathway
ngi04917  Prolactin signaling pathway
ngi04930  Type II diabetes mellitus
ngi04935  Growth hormone synthesis, secretion and action
ngi05145  Toxoplasmosis
ngi05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103731577 (Socs1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103731577 (Socs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103731577 (Socs1)
   04917 Prolactin signaling pathway
    103731577 (Socs1)
   04935 Growth hormone synthesis, secretion and action
    103731577 (Socs1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103731577 (Socs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103731577 (Socs1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103731577 (Socs1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103731577 (Socs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103731577 (Socs1)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     103731577 (Socs1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 103731577
NCBI-ProteinID: XP_008828148
LinkDB
Position
Un
AA seq 217 aa
MVARNQVAADNAISPAAEPRRRPEPSSSSTSSSSSSSSPAVPARPRPCPAVPAPAPGDTH
FRTFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFA
LSVKMASGPTSIRVHFQAGRFHLDGSRETFDCLFELLEHYVAAPRRMLGAPLRQRRVRPL
QELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 654 nt   +upstreamnt  +downstreamnt
atggtagcacgcaaccaagtggcagccgacaatgcgatctccccggcagcagagcccaga
cggcggccagagccttcgtcctcgtccacgtcttcatcttcgtcctcgtcctcgccggcc
gtccctgcgcgtccgcggccctgcccggcggtcccggcaccggcccccggcgacacgcat
ttccgcacgttccgctcccacgccgattaccggcgcatcacgcgggccagcgcgctcctg
gacgcctgcggcttctactgggggcccctgagcgtgcacggggcgcacgagcggctgcgc
gccgagccggtgggcaccttcctggtgcgcgacagtcgccagcggaactgcttcttcgcg
cttagcgtgaagatggcctcgggccccacgagcatccgcgtgcacttccaggccggtcgc
ttccacctggatggcagccgcgagaccttcgactgcctcttcgagctgctggagcactac
gtggcggccccgcgccgcatgctgggggccccgctgcgccagcgccgcgtgcggccgctg
caggagctgtgtcgccagcgcatcgtggccaccgtgggacgagagaacctggcgcgcatc
cccctcaaccctgtcctccgagactacctgagttccttccccttccagatctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739222
Entry
103739222         CDS       T03372                                 

Gene name
Socs4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04630  JAK-STAT signaling pathway
ngi04910  Insulin signaling pathway
ngi04917  Prolactin signaling pathway
ngi04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103739222 (Socs4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103739222 (Socs4)
   04917 Prolactin signaling pathway
    103739222 (Socs4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103739222 (Socs4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103739222 (Socs4)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     103739222 (Socs4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 103739222
NCBI-ProteinID: XP_008837762
LinkDB
Position
Un
AA seq 440 aa
MAENNENNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSDAETVGAVEKTEV
PLRSQERKHSCASIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSPGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPISPKSDEWVSTDLPQSESRDAQLKRRN
MEEDINSFSHTNIQPCVITTNDVSCRGGHMTGSMMNLVTNNSIEDSDMDSDDEIITLCTS
SRKRNKPKWDMDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPASMKLYLK
EYHYKSKVRVLRIDAPEQQC
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcagaaaataatgaaaataatagtaaaaatgtagatgtaaggcctaaaacaagtcga
agtagaagtgctgacagaaaagacggttatgtgtggagtggaaagaagttatcttggtca
aaaaagagtgagagttgttcagatgctgaaacagtgggtgctgtagagaaaactgaagtt
cctttaaggagccaagagaggaagcacagctgtgcatctattgagttggatttagatcat
tcctgtgggcatagatttttaggacgatctcttaaacagaaactgcaagatgctgtgggg
caatgttttccaataaagaattgtagcagtcggcattctccagggcttccatctaaaaga
aaaattcatatcagtgaactcatgttagataagtgtcctttcccacctcgatcagattta
gcctttagatggcattttattaaacgacacactgctcctataagtcccaaatcagatgag
tgggtaagcacagacttacctcagagtgaatcaagggatgctcagctaaaacgaagaaac
atggaagaagatataaacagtttctcacatactaatattcagccttgtgtcataactacc
aacgatgtttcatgtagaggtggtcacatgactggctctatgatgaacctggttacaaat
aacagtatagaagatagtgatatggattccgatgatgaaattataacactttgcacaagt
tccagaaaaagaaacaaacccaaatgggatatggatgatgaaatcctgcagttggaaaca
cctccaaagtaccacacccagattgattatgtccactgtcttgtaccagaccttcttcaa
atcaataacaatccgtgttattggggagttatggataaatatgcagctgaagctctacta
gaaggaaaaccagagggtacctttttacttcgagactcagcacaggaagattatttattc
tccgttagttttagacgctatagtcgttctcttcatgctagaattgaacagtggaaccac
aacttcagttttgatgcacatgatccttgtgtcttccattctcctgacattactgggctc
ctagaacattataaggacccaagtgcctgtatgttctttgaaccacttttatccactcct
ttaattcggactttccccttttccctgcagcatatttgcagaacagttatttgtaattgt
acaacttacgatggcattgatgcccttccaattcctgcgtcaatgaaactatatctgaag
gaataccattataaatcaaaagttagagtactcaggattgatgcaccagaacaacagtgc
tag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743791
Entry
103743791         CDS       T03372                                 

Gene name
Socs7
Definition
(RefSeq) suppressor of cytokine signaling 7
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103743791 (Socs7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103743791 (Socs7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103743791 (Socs7)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     103743791 (Socs7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 103743791
NCBI-ProteinID: XP_008843483
LinkDB
Position
Un
AA seq 577 aa
MVFRNVGRPPEEEDVEAAPQSGASELLCSRHRCALDPKALPPGLALERTWGPVAGLEAQL
AALGLAQSAGPGVKAAGAGCCPCPCPPQPPPPQQPQPLAAAPQAGEDPTETSDALLVLEG
LESEAESLETNSCSEEDLSSPGRGPGGGGRLVLQPPGPELPPVPFPLQDLVPPGRLSRGE
QQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGHGTGKRPSGDLVAS
AASLTDMGGSAARELDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTSPH
PPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIAPIRA
AESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLV
RDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKN
GKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPL
ISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggtgttccgcaacgtgggtcggccgccggaggaggaggacgtggaggcggctccgcag
tcgggagcctcggaactgctgtgttcccggcaccgctgtgcgctggaccccaaggccctg
ccgcctggcctggctctcgagcggacctgggggccggtggctggactagaggcgcagctg
gcggcgctggggctagcgcagtcggcggggccgggagtgaaggcggccggggcgggctgc
tgcccctgcccgtgtcccccgcagccgcccccgccgcagcagccccagccgcttgctgcc
gccccgcaggccggggaggaccccacggaaacgagcgacgcgctgctggtcctggaaggc
ttggaatcggaggccgagagcctggagactaacagctgctcagaagaggacctcagcagc
ccgggtcgggggccaggagggggtggccggcttgtgctgcagcccccgggtcccgaactg
cctccggtgcccttcccgttgcaggacttggtcccccctgggcgcctgagtcgaggggag
cagcagcagcctcctcccccgccgccgcctcccgggcccctccggccccttgctggcccg
tctcggaagggctccttcaaaatccgcctcagtcgcctgtttcgcacgaagagctgcaac
ggtggctcgggaggtgggcatgggaccggcaagaggccttctggagatctagttgcttca
gctgcgagcctgacggacatgggaggctctgcggcccgagagctggatgcggggaggaaa
cccaggttgacaagaactcaaagtgccttttctccggtctccttcagccccttgttcaca
ggtgagacagtgtcgcttgtggacgtggacatttctcagcggggcctgacctctccacat
cctccaactccccctcctcctccacgaagaagcctcagcctcctagatgatatcagtggg
acgctgcctacatctgtccttgtggctccgatggggtcttccttgcagtctttcccccta
cctccgcctcctccaccccacgccccagatgcatttccccggattgctcccattagagca
gctgaatccctgcacagccagcccccccagcacctccagtgtcccctgtaccgacctgac
tcaagcagctttgcagccagccttcgagagttggagaagtgcggttggtattgggggcca
atgaattgggaagatgcagagatgaagctgaaagggaagccagatggttctttcttggta
cgagacagctctgatcctcgctatatcctgagcctcagttttcgatcacagggtatcacc
catcacaccagaatggagcactatagaggaaccttcagcctatggtgccatcccaagttt
gaggatcgctgtcagtctgtggtagagttcattaagagagccatcatgcactccaagaat
ggaaagttcctctatttcttaagatccagggtaccaggactgccaccaactccagtacag
ctgctctatccagtgtcccgattcagcaatgtcaaatcccttcagcacctttgcagattt
cggatccggcagctcgtccgaatagatcatatcccggatcttccactgcccaaaccgctg
atctcttatattcgaaagttctactattatgatcctcaggaagaggtgtacctgtctcta
aaggaagcgcagctcatttccaaacagaagcaagaggtggagccctcaacgtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747288
Entry
103747288         CDS       T03372                                 

Gene name
Socs3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04120  Ubiquitin mediated proteolysis
ngi04380  Osteoclast differentiation
ngi04630  JAK-STAT signaling pathway
ngi04668  TNF signaling pathway
ngi04910  Insulin signaling pathway
ngi04917  Prolactin signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04930  Type II diabetes mellitus
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04935  Growth hormone synthesis, secretion and action
ngi05160  Hepatitis C
ngi05164  Influenza A
ngi05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103747288 (Socs3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103747288 (Socs3)
   04668 TNF signaling pathway
    103747288 (Socs3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103747288 (Socs3)
   04920 Adipocytokine signaling pathway
    103747288 (Socs3)
   04917 Prolactin signaling pathway
    103747288 (Socs3)
   04935 Growth hormone synthesis, secretion and action
    103747288 (Socs3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103747288 (Socs3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    103747288 (Socs3)
   05164 Influenza A
    103747288 (Socs3)
   05168 Herpes simplex virus 1 infection
    103747288 (Socs3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103747288 (Socs3)
   04932 Non-alcoholic fatty liver disease
    103747288 (Socs3)
   04931 Insulin resistance
    103747288 (Socs3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103747288 (Socs3)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     103747288 (Socs3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 103747288
NCBI-ProteinID: XP_008847864
LinkDB
Position
Un
AA seq 229 aa
MVTHSKFPAAGMNRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAASFSLPSTEPSSSPSSEVPEQQPAQSLPGGTPRRAYYIYSGGEKIPL
VLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 690 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgaaccgtcccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtacgcaag
ctgcaggagagcggattctactggagcgctgtgaccggcggcgaggccaacctgctgctt
agcgccgagccagcgggcaccttcctcatccgcgacagctcggaccagcgccacttcttc
acactcagtgtcaagacccagtcggggaccaagaacctgcgcatccagtgcgaggggggc
agcttctcgctccagagtgacccccggagcacgcagccggtgccccgcttcgattgcgta
ctcaagctggtgcatcactacatgcctccccccggcgccgcctccttctctttaccatcg
acggaaccctcctcctcaccctcttccgaggtgccggagcagcaacctgcccagtcactc
cctgggggtacccctaggagagcttactacatctattctgggggcgagaagattcccctg
gtattgagccggcccctctcctccaacgtggccacccttcagcatctctgtcggaagact
gtcaacggccacctggactcctatgagaaagtcactcagctgcccggacccattcgggag
ttcctggaccagtatgatgccccgctttaa

DBGET integrated database retrieval system