KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725901
Entry
103725901         CDS       T03372                                 

Gene name
Tgfa
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04915  Estrogen signaling pathway
ngi05200  Pathways in cancer
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05223  Non-small cell lung cancer
ngi05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103725901 (Tgfa)
   04012 ErbB signaling pathway
    103725901 (Tgfa)
   04014 Ras signaling pathway
    103725901 (Tgfa)
   04151 PI3K-Akt signaling pathway
    103725901 (Tgfa)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103725901 (Tgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103725901 (Tgfa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103725901 (Tgfa)
   05212 Pancreatic cancer
    103725901 (Tgfa)
   05225 Hepatocellular carcinoma
    103725901 (Tgfa)
   05214 Glioma
    103725901 (Tgfa)
   05211 Renal cell carcinoma
    103725901 (Tgfa)
   05215 Prostate cancer
    103725901 (Tgfa)
   05223 Non-small cell lung cancer
    103725901 (Tgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103725901 (Tgfa)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 103725901
NCBI-ProteinID: XP_008821467
LinkDB
Position
Un
AA seq 159 aa
MVPAAGQLTLLALGIVLAVCQALENSTSPLSDPPVAAAVVSHFNECPDSHTQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQLRKHCDWCRALVCRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtccccgcggccggacagctcaccctgctcgcgctgggtatcgtgttggctgtgtgt
caggctttggagaacagcacatctcccctgagcgacccacctgtggctgctgcagtggtg
tctcacttcaacgaatgcccggattcccacactcagttctgcttccatgggacttgcagg
tttttggtacaggaggacaagccagcatgtgtctgccattccgggtacgtgggtgctcgc
tgcgaacatgcggacctcctggccgtggtggccgccagccagaagaagcaggccatcacc
gccttggtggtggtctccattgtggccctagctgtcctcattatcacctgtgtgctgatc
cactgctgccagctccgcaagcactgtgactggtgccgtgccctcgtctgcagacacgag
aagcccagtgccctcctgaagggaaggactgcttgttgccactctgagacagtggtctga

DBGET integrated database retrieval system