KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726107
Entry
103726107         CDS       T03372                                 

Gene name
Braf
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04015  Rap1 signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04068  FoxO signaling pathway
ngi04150  mTOR signaling pathway
ngi04270  Vascular smooth muscle contraction
ngi04510  Focal adhesion
ngi04650  Natural killer cell mediated cytotoxicity
ngi04720  Long-term potentiation
ngi04722  Neurotrophin signaling pathway
ngi04726  Serotonergic synapse
ngi04730  Long-term depression
ngi04810  Regulation of actin cytoskeleton
ngi04910  Insulin signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05034  Alcoholism
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05216  Thyroid cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103726107 (Braf)
   04012 ErbB signaling pathway
    103726107 (Braf)
   04015 Rap1 signaling pathway
    103726107 (Braf)
   04068 FoxO signaling pathway
    103726107 (Braf)
   04024 cAMP signaling pathway
    103726107 (Braf)
   04150 mTOR signaling pathway
    103726107 (Braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103726107 (Braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103726107 (Braf)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103726107 (Braf)
   04062 Chemokine signaling pathway
    103726107 (Braf)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103726107 (Braf)
   04914 Progesterone-mediated oocyte maturation
    103726107 (Braf)
   04928 Parathyroid hormone synthesis, secretion and action
    103726107 (Braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103726107 (Braf)
  09156 Nervous system
   04726 Serotonergic synapse
    103726107 (Braf)
   04720 Long-term potentiation
    103726107 (Braf)
   04730 Long-term depression
    103726107 (Braf)
   04722 Neurotrophin signaling pathway
    103726107 (Braf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103726107 (Braf)
   05205 Proteoglycans in cancer
    103726107 (Braf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103726107 (Braf)
   05212 Pancreatic cancer
    103726107 (Braf)
   05225 Hepatocellular carcinoma
    103726107 (Braf)
   05226 Gastric cancer
    103726107 (Braf)
   05214 Glioma
    103726107 (Braf)
   05216 Thyroid cancer
    103726107 (Braf)
   05221 Acute myeloid leukemia
    103726107 (Braf)
   05220 Chronic myeloid leukemia
    103726107 (Braf)
   05218 Melanoma
    103726107 (Braf)
   05211 Renal cell carcinoma
    103726107 (Braf)
   05219 Bladder cancer
    103726107 (Braf)
   05215 Prostate cancer
    103726107 (Braf)
   05213 Endometrial cancer
    103726107 (Braf)
   05224 Breast cancer
    103726107 (Braf)
   05223 Non-small cell lung cancer
    103726107 (Braf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103726107 (Braf)
   05022 Pathways of neurodegeneration - multiple diseases
    103726107 (Braf)
  09165 Substance dependence
   05034 Alcoholism
    103726107 (Braf)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103726107 (Braf)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103726107 (Braf)
   05160 Hepatitis C
    103726107 (Braf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103726107 (Braf)
   01522 Endocrine resistance
    103726107 (Braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103726107 (Braf)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103726107 (Braf)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   103726107 (Braf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 103726107
NCBI-ProteinID: XP_008821740
LinkDB
Position
Un
AA seq 798 aa
MEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEE
YTSKLDALQQREQQLLESLGNGTDFSVSSSASMDTVTSSSSSSLSVLPSSLSVFQNPTDV
SRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGY
GLEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRC
QTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEASLAETALTSGSSPSAP
PSDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDE
KFPEVELQDQRDLIRDQGFRGDGAPLNQLMRCLRKYQSRTPSPLLHSVPSEIVFDFEPGP
VFRGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDD
WEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTR
HVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHA
KSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQD
KNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAM
KRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACA
SPKTPIQAGGYGEFAAFK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atggagcccgaggccggcgcgggcgccgcggcctcctcggctgccgacccggccattcct
gaggaggtgtggaatatcaaacaaatgattaaattgacacaggaacatatagaagcccta
ttggacaaatttggtggggagcataatccaccatcaatatacttggaggcctatgaagaa
tacaccagcaagctagatgccctccaacaaagagaacaacagttattggaatccctgggg
aatggaactgatttttctgtttctagctctgcatcaatggacaccgttacatcctcttct
tcttctagcctttcagtgctaccttcatctctttcagtttttcaaaatcccacagatgta
tcacggagtaaccccaagtcaccacaaaaacctatcgttagagtcttcctgcccaacaaa
cagagaacagtggtacctgcaagatgtggagtgacagtccgagacagtctaaagaaagca
ctaatgatgagaggcctcatcccagagtgctgtgccgtttacagaattcaggatgggtat
ggtttagagaagaaaccaattggctgggacactgatatatcttggctgactggggaagag
ttacatgtggaagtattggagaatgtgccacttaccacacacaactttgtacggaaaacg
tttttcaccttagcattttgtgacttttgtcgaaagctgcttttccagggtttccgctgt
caaacatgtggttataagtttcaccaacgttgtagtacagaggttccactgatgtgtgtt
aattatgaccagcttgatttgctgtttgtctccaagttctttgagcatcacccaatacca
caggaagaggcctccttagcagagactgcccttacatctggatcatccccttctgcaccc
ccctcagactctattgggccccaaattctcaccagtccatctccttcaaaatccattcca
attccacagcccttccgaccagcagatgaagatcatcgaaatcagtttgggcaacgagac
cggtcctcctcagctcccaatgtgcatataaatacaatagaacctgtcaatattgatgaa
aaattcccagaagtggaattacaggatcaaagggatttgattagagaccaagggtttcgt
ggtgatggagcccccttgaaccagctgatgcgctgtcttcggaaataccaatcccggact
cccagccccctcctacattctgtccccagtgaaatagtgtttgattttgagcctggccca
gtgttcagagggtcaaccacaggtttgtctgccaccccacctgcctcattacctggctcc
ctcactaatgtgaaagccttacagaaatctccaggacctcagcgggaaaggaaatcatct
tcatcctcagaagatagaaatcgaatgaaaacacttggtagacgagattcaagtgatgat
tgggagattcctgatggacagattacagtgggacagagaattggatctgggtcatttgga
actgtctacaaaggaaagtggcatggtgatgtggcagtgaaaatgttgaatgtgacggca
cccacacctcaacagctacaagccttcaaaaatgaagtaggagtactcaggaaaacacga
catgtgaatatcctacttttcatgggctattcaacaaagccacaactggctattgttacg
cagtggtgtgaaggctccagcttgtatcaccatctccatatcattgagaccaaatttgag
atgatcaaacttatagatattgcacggcagactgcacagggcatggattacttacacgcc
aagtcaatcatccacagagacctcaagagtaataatatatttcttcatgaagacctcacg
gtaaaaataggtgattttggtctagccacagtgaaatctcgatggagtgggtcccatcag
tttgaacagttgtctggatccatcttgtggatggcaccagaagtaatcaggatgcaagat
aaaaacccatatagctttcagtcagatgtatatgcctttgggattgttctgtacgaactg
atgactggccagctaccttattcaaacatcaacaacagggatcagataatttttatggtg
ggacgaggatacctatctccagatctcagtaaggtacggagtaactgtccaaaagccatg
aagagattaatggcagagtgcctcaaaaagaaaagagatgaaagaccactctttccccaa
attctcgcctctattgagctgctggcccgctcattgccaaaaattcaccgcagtgcatca
gaaccctccttgaatcgggctggtttccagacagaagattttagtctgtacgcttgtgct
tctccaaaaacacccatccaagcagggggatatggagagtttgcagccttcaagtag

DBGET integrated database retrieval system