KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726140Help
Entry
103726140         CDS       T03372                                 

Gene name
Mgam
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00052  Galactose metabolism
ngi00500  Starch and sucrose metabolism
ngi01100  Metabolic pathways
ngi04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103726140 (Mgam)
   00500 Starch and sucrose metabolism
    103726140 (Mgam)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103726140 (Mgam)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     103726140 (Mgam)
    3.2.1.20  alpha-glucosidase
     103726140 (Mgam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil DUF5110 Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103726140
NCBI-ProteinID: XP_008821778
LinkDB All DBs
Position
Un
AA seq 1029 aa AA seqDB search
MARRVFKRFTVLELVLIVLLIVLFIIAVVLIVLLANSTGPNALNDNTTSVPGSTTTRTTV
NSPDCPVLNELERINCIPDQTPTEAICDQRDCCWNPQAGINVPSCYYSKNHGYQIDSDAV
NTNSGFTAQLRNRPSASVFGDDIENILLTAEYQTSNRFHFKFTDQAKARYEVPHEHVQPF
SGNAASSLNYKVEVSKQPFSIKVTRASNNRVLFDSSIGPLLFSDQYLQFSTLLPSTNVYG
LGEHVHQQYRHDMNWKTWPIFARDTIPNEDGTNLYGAQTFFLCLEDDSGLSFGVFLMNSN
AMEIALQPTPAITYRITGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWSLGFHLSQY
DYGSLEKMKEVVDRNRAAQLPYDVQHGDIDYMDQRKDFTYDPVNFKGFPEFAKDLHNNGQ
KLVIILDPAISSASSSSNPYGPYDRGSTMKIWVNASDGINPLIGQVWPGITVFPDYTNPS
CVVWWAKEIELFHKTLEFDGIWIDMNEVANFVDGSVSGCAKNNLNYPPFTPKILDGHLFS
KTLCMDAVQHWGKQYDVHNLYGYSMAIATEEAVKTVFPDKRSFILTRSTFAGSGKFAAHW
LGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGFTLDTSEELCRRWMQLGAFYPFSRN
HNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLLYHSHSRGDTVARPLLHEF
YKDSNTWDIHRQFLWGPGLLITPVLDEGAEKVTAYVPDAVWYDYETGGQLTWRKQSAEMV
LPGDKIGLHLRGGYIFPTQQPGITTTVSRKNPLGLIIALDENKEAKGELFWDDGETKDTV
AKNTYLLCEFSATQNRLDVTISKSNYKDPNELAFQEIKILGTQAIRDVTVKQNNVLSQMS
PQITYDPNMKVAIITNIHLVLGEAYVMEWEEHDIRDEEKIDCYPDEHGASKETCTARGCV
WEESSSSGVPFCYFVSDLYSVSNIQDQSHGVTADISLKASPYSHAFPSTPVNHLRLQVTY
HTDEMLQFK
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagagtgtttaaacggttcaccgttttggagcttgttctcattgttcttctg
attgtgctgttcatcattgccgttgtcctaattgtgcttttagccaattctacgggacca
aatgccttaaatgataacacgactagtgtgccaggctctacgaccacaaggaccactgtt
aattctcctgattgtccagtactaaatgaattggaacggataaactgcatccctgatcag
acacctacagaggccatttgtgaccagcgtgactgctgctggaatccccaggcaggtatc
aatgtcccttcctgctactactccaagaatcatggctaccaaatcgatagtgatgcagta
aacacaaattcaggattcacagcccagttgcgaaatcgcccatctgcatccgtgtttgga
gatgacattgaaaacatccttctcacagcagaataccagacatccaaccgtttccacttt
aagttcactgaccaagccaaagccaggtatgaagtgccccacgaacatgtgcaacccttc
agtggaaatgctgcctcttccttgaactacaaagttgaggtgtccaaacagccatttagc
atcaaagtcaccagagcaagcaataatcgtgtgctgtttgactcaagcattgggcccctc
ctgttttcagatcaatacctgcaattctccaccctcctgccaagtactaatgtatatggt
ctaggggaacatgtgcaccagcagtaccggcatgacatgaattggaagacctggcccata
tttgctagagacacaatccccaatgaggatggaactaatttgtatggtgctcagacattc
ttcctgtgcctggaagatgacagtgggttatcctttggggtatttctgatgaacagcaat
gccatggagattgccctccagcccaccccagcaatcacatacagaattactgggggtatt
ctggacttctatgtgttcttgggaaacacacctgagcaagttgttcaagaatatctagag
ctcattggacgaccagccctgccttcatactggtcacttggatttcacctcagccaatat
gattacggaagcctggagaagatgaaagaagttgtggacagaaaccgtgcagcacagctc
ccttatgatgttcagcatggtgatatcgattacatggaccagaggaaggacttcacgtat
gacccagtgaattttaaaggcttccctgagtttgctaaggatttacacaataatggacag
aaacttgtcatcatcttggatccagccatttccagtgcctcttcctcaagcaatccttat
ggcccatatgacaggggttcaacaatgaaaatatgggtgaatgcttccgatggcataaac
ccacttattggacaggtctggcctggaataactgtatttccggattacaccaatcccagc
tgtgttgtttggtgggcaaaagaaattgagcttttccataaaacgctggagtttgatgga
atctggattgatatgaatgaagtcgccaactttgttgatggttcagtttcaggatgtgca
aaaaacaacttaaattatcccccattcactccaaagatcttggatgggcacttattctct
aagactctctgcatggatgcagttcagcactggggcaagcagtatgatgtccacaacctg
tatggctactccatggccattgctacagaagaagctgtgaagacagtgttccctgataag
agaagcttcatcctaactcggtctacctttgcgggctctggcaagtttgcagcccattgg
ttaggagataatactgccacctggaaagaccttcagtggtccatccctggcatgcttgaa
ttcaacctctttggaatccccatggtgggggcagatatatgtggctttaccttggacaca
tctgaagagctctgcaggcggtggatgcagctgggggcattttatccattttccagaaat
cacaacggccaaggttacaaggaccaggaccctgcctcctttggagctgattccttgctg
ttgaattcctccaggcactaccttaacatccgttatacactgctgccttacctctacact
ctcttataccactcccacagccgtggggacacggtagccaggccccttctgcatgagttc
tacaaggacagcaacacttgggatatacaccgacagtttctatgggggccaggcctcctc
atcactcctgttctggatgagggtgcagagaaagtgacggcatatgtgcctgatgctgtc
tggtatgattatgagaccgggggccaattgacatggaggaagcaaagcgctgagatggta
cttcctggagacaaaattggacttcaccttcgaggaggctacatcttccccacacaacag
ccaggcataaccacaacagtcagccggaagaaccctcttggccttatcattgccctggat
gagaacaaagaagcaaaaggcgagctgttctgggatgatggagaaacaaaggataccgtg
gccaaaaacacgtaccttttatgtgaattttctgccacccaaaaccgattggacgtgact
atttcaaaatcaaactacaaggatcccaatgagttagcatttcaggaaattaaaatcctt
gggacacaggcaattcgtgatgttacagtgaaacagaataatgtcctcagtcaaatgtct
cctcaaatcacatatgatcctaacatgaaggttgccatcattacaaatatccatcttgtt
ctgggagaagcatacgtgatggagtgggaggagcatgacataagagatgaggaaaaaata
gactgctatccagatgagcatggtgcctctaaggaaacgtgcactgcccgtggctgcgtc
tgggaggaatccagctcttccggggtccccttttgctattttgtcagtgatctgtactca
gtcagcaatatacaggatcaatcccatggggtcacagctgacatctccttaaaagcatct
ccatatagccacgcgttcccgtccacaccagtcaaccacctccgactgcaagtgacctac
cacacggatgaaatgctgcagtttaag

DBGET integrated database retrieval system