KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726185
Entry
103726185         CDS       T03372                                 

Gene name
Kng1
Definition
(RefSeq) kininogen 1
  KO
K03898  kininogen
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04080  Neuroactive ligand-receptor interaction
ngi04610  Complement and coagulation cascades
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04810  Regulation of actin cytoskeleton
ngi05142  Chagas disease
ngi05143  African trypanosomiasis
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    103726185 (Kng1)
   04022 cGMP-PKG signaling pathway
    103726185 (Kng1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103726185 (Kng1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103726185 (Kng1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    103726185 (Kng1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103726185 (Kng1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103726185 (Kng1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103726185 (Kng1)
   05143 African trypanosomiasis
    103726185 (Kng1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ngi01002]
    103726185 (Kng1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103726185 (Kng1)
Peptidases and inhibitors [BR:ngi01002]
 Peptidase inhibitors
  Family I25: cystatin family
   103726185 (Kng1)
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   103726185 (Kng1)
  Exosomal proteins of other cancer cells
   103726185 (Kng1)
SSDB
Motif
Pfam: Cystatin Cathelicidins Spp-24 Bradykinin DUF755
Other DBs
NCBI-GeneID: 103726185
NCBI-ProteinID: XP_008821860
LinkDB
Position
Un
AA seq 646 aa
MKLITILFLFSRLLPSLSQDMAPQEIDCNDEDVFQAVDAALKKYNARNHTGNQFVLYRVS
EATKMVGTDIFYSFKYQIKEGNCSVQSGKTWQDCEYKDAQEAATGACTATVGKRRNMNFS
VATQTCQITPAEGPTVRAEYTCLGCVHPIPTDSPDLEQLLKHGIEHFNNNTDHSHLFALE
EVKIAQRQVVAGFNFEITYSIVQTNCSKEKFLFLTPECKSLLNSDVGECRDKVYVNIEQK
IAAFSQSCDLYPGEDLVQPLPKSCPGCPQDIPADSPDLKDALDHSIRKLNAENNATFYFK
IDTVKKATSQVVGGIKYVIEFTAKETECSKESNTELTANCEAKQPGQSLSCTAEVYMRLW
EKKVFPTVKCQPLEMVTMMRRPPGFSPFRTVQVQETKEGTTVSPPYTSVMPVHEEQDPES
EQGPAHGHDRFHENPKIGHGHKHEHDQVHSPPKRHGLGHGHQKQHDLGHGHQLKLDHNLK
HPKGHGFGHGHPTGHDIAHKHKHGRDHEQRKNKDKISGKHTDRRTESSASSSEDSSTSTQ
TPGRTEGPSTLPPLVQPSVAVTSGFEDSDLIEGMVAASPSNPTEIDDDLIPDIHVQADRL
LFKLIPDFPETAPHNCPGRPWKPGNRKNPTMEMKEFSDFELSDALS
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgaagctgattaccatccttttcctcttctccaggctgctaccaagtttaagtcaagac
atggcgccccaggaaattgactgcaatgacgaggatgtttttcaggctgtggatgccgct
ctgaagaagtataatgccaggaaccacactggcaaccagtttgtgttgtaccgtgtttct
gaggccactaaaatggttggtactgacatattttattccttcaagtatcaaatcaaggag
ggtaactgttctgtccaaagtggtaaaacgtggcaagactgtgaatacaaggacgctcag
gaagctgccacaggagcatgtacagcaaccgtggggaagagaagaaatatgaacttctct
gtggcgacccagacctgccagattaccccagccgagggccccacggtaagagcggagtat
acttgcctgggctgtgtgcatccgatacctactgacagccccgacctggagcagcttctg
aaacatggcattgaacacttcaacaataacacggatcattcccatctctttgctcttgag
gaagtaaaaatagcccaaagacaggtggtggctggatttaactttgaaattacctactca
attgtgcaaaccaattgttccaaggagaagtttctattcctaactccagagtgcaagtcc
cttctgaacagtgatgttggtgagtgtagagataaggtgtatgtgaacattgaacaaaaa
attgctgcattctcccagagctgtgatctctatccaggggaggatttggtacaaccactt
cccaagagctgccctggatgcccccaggacataccggcagacagccctgacctgaaggat
gcacttgatcattctatcagaaagctcaatgcagagaataacgcaaccttctatttcaag
attgacactgtgaaaaaagctacatcacaggtggtaggtggaattaaatatgttattgag
ttcacagccaaagagactgaatgttccaaagaaagtaacacagaattgacggcaaactgt
gaggccaaacaacctggtcaaagtctcagctgcactgctgaagtttacatgaggctttgg
gagaagaaagttttccccactgtcaagtgtcaaccactggaaatggttacaatgatgaga
aggcctccgggtttttcacctttccgaacggtacaagtacaggaaacaaaagaaggaaca
actgtaagtccaccctacacttccgtgatgcctgtccatgaagagcaggatccagaaagt
gaacaagggcccgctcatgggcatgaccggtttcatgaaaatcctaagattggccatggt
cataaacatgagcatgaccaagtccattccccgccaaagaggcatggccttggtcatgga
catcaaaaacagcatgaccttggtcatggacatcagcttaaacttgatcataatcttaaa
catccaaagggacatggctttggccatggccatccaactggacatgacatagctcataaa
cataagcatggtcgtgaccatgaacaacgcaaaaataaagacaaaatcagtggaaagcac
actgaccggagaacagagtcttcagcaagctcttctgaggatagttctacatctacacag
acaccagggaggacagaagggccaagcactctcccgcccctagtccagcccagtgtagca
gtcacttctggctttgaggactcggatctcattgaaggtatggtggctgcctcgccatca
aatcccacagagatcgatgatgatttgatccctgatatccacgtacaagccgataggctt
ttgtttaagctgatacctgattttccagaaacagccccccacaactgtcctggccgtcca
tggaagccaggtaatagaaagaatccaaccatggaaatgaaagagttttctgattttgaa
ctctctgatgctctctcttaa

DBGET integrated database retrieval system