KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726215
Entry
103726215         CDS       T03372                                 

Gene name
Shc3
Definition
(RefSeq) SHC adaptor protein 3
  KO
K17448  SHC-transforming protein 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04510  Focal adhesion
ngi04650  Natural killer cell mediated cytotoxicity
ngi04722  Neurotrophin signaling pathway
ngi04910  Insulin signaling pathway
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04926  Relaxin signaling pathway
ngi04935  Growth hormone synthesis, secretion and action
ngi05034  Alcoholism
ngi05100  Bacterial invasion of epithelial cells
ngi05214  Glioma
ngi05220  Chronic myeloid leukemia
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103726215 (Shc3)
   04014 Ras signaling pathway
    103726215 (Shc3)
   04072 Phospholipase D signaling pathway
    103726215 (Shc3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103726215 (Shc3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103726215 (Shc3)
   04062 Chemokine signaling pathway
    103726215 (Shc3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103726215 (Shc3)
   04915 Estrogen signaling pathway
    103726215 (Shc3)
   04917 Prolactin signaling pathway
    103726215 (Shc3)
   04926 Relaxin signaling pathway
    103726215 (Shc3)
   04935 Growth hormone synthesis, secretion and action
    103726215 (Shc3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103726215 (Shc3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103726215 (Shc3)
   05226 Gastric cancer
    103726215 (Shc3)
   05214 Glioma
    103726215 (Shc3)
   05220 Chronic myeloid leukemia
    103726215 (Shc3)
   05224 Breast cancer
    103726215 (Shc3)
  09165 Substance dependence
   05034 Alcoholism
    103726215 (Shc3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103726215 (Shc3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103726215 (Shc3)
   01522 Endocrine resistance
    103726215 (Shc3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 103726215
NCBI-ProteinID: XP_008821900
LinkDB
Position
Un
AA seq 592 aa
MLPRTKYNRFRDDAVTSADDLLHSLSVSGGKVSAAAAATPYLVSGEALRKAPDDGPGSLG
HLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPEGGSATPGSRAQAASMS
AARKGRPGDEPLPRTPRGAPHANDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQITR
EAISRVCEAVPGAKGAFKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSK
QIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQAFE
LRFKQYLQCPSKIPALQDRMQSLDEPWTEEEGDGPDHPYYNSVPSKMPPPGGFLDARLKT
RPHAPDAAQFSGKEQTYYQGKHLGDTFGEDWQRAPVRQASLDIYSTPEGKVHLAPAGELP
TYVNTQPAPPHVWPATISSTESSPRKDLFDMKPFEDALKNQPLGPILNKAASVECISPVS
PRAPDARMLEELNTEPWYQGEMSRKEAEALLEEDGDFLVRKSTTNPGSFVLTGMHNGQAK
HLLLVDPEGTIRTKDRVFDSISHLINYHLESSLPIISAGSELCLQQPVKRKH
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgcttccaaggaccaaatacaaccgcttcagggatgacgcggtgacatcggccgatgac
cttctccacagcttgtcggtgagcggcggcaaggtctcggcggcggccgcggcgaccccc
tacctggtgtcgggcgaggcgctgcgcaaggcgccagacgatgggcccggcagcctgggc
cacctgctccacaaggtgtcccacctgaaactctccagctccggcctgcgcggcctgtcg
tccgccgcccgggagcgtgcgggcgcgaggctctcgggcagctgcagcgcgcccagcctg
gccgccccagaaggcggcagcgcaacccctgggtcccgcgcccaggccgccagcatgagc
gccgccaggaagggtcggccgggcgacgagccgctgcccaggaccccgcggggcgctccg
cacgccaacgaccaggtgctggggcccggagtcacctatgtggtcaagtacttggggtgc
atcgaagttctgcgctcgatgaggtctcttgacttcagtacaagaacacagattaccagg
gaagccatcagccgtgtctgtgaagctgtgcctggtgccaaaggagccttcaagaagaga
aagcctccaagtaaaatgctgtccagcatcctggggaagagcaaccttcagtttgcaggg
atgagcatctccctgaccatctccactgccagcctgaacttgcgcacacctgactccaaa
cagatcatagcgaaccatcacatgcagtccatctcctttgcctcagggggagacccggac
acaacagactatgttgcctatgtcgctaaggaccctgttaatcgcagagcttgccacatt
ctggaatgctgtgacgggttggcccaagatgtcatcggctccattggacaagctttcgaa
ctccggtttaaacaatatttacagtgtccttccaagatccctgccctccaggaccgaatg
cagagtttggatgagccatggacagaagaggagggagatggccctgaccacccatactac
aacagtgttcctagcaagatgcctcctccaggggggtttcttgatgctcgactgaaaacc
agaccccatgctcctgatgcagcccagttttcaggaaaggagcaaacttattaccaggga
aaacatttaggagatacatttggcgaagactggcagcgagcacccgtcaggcaagcctcc
ttggacatctacagcacaccagaagggaaagtacacctggctcctgcaggagaattacca
acctatgtcaacacccagccagcccctccacatgtctggccagccacaatcagcagcaca
gagagcagcccacggaaggacctctttgacatgaagccttttgaagatgctctcaagaac
cagcccttgggacctatattgaacaaagcagcatctgtggagtgcatcagtcctgtctcg
cccagagctccagatgccaggatgctggaggagctcaacaccgagccctggtaccaagga
gagatgagcaggaaggaggctgaggcactattggaagaagacggagacttcctggtcaga
aagagcaccaccaaccctggttccttcgttctcaccggcatgcataatggtcaggccaag
catctgctgctggtggaccctgagggcacgatccggacgaaagacagggtctttgacagc
atcagccacctcatcaactaccaccttgagagcagcctgcccatcatctctgctgggagt
gagctctgcctccagcagccagtgaagaggaaacactga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103733036
Entry
103733036         CDS       T03372                                 

Gene name
Shc4
Definition
(RefSeq) SHC adaptor protein 4
  KO
K17449  SHC-transforming protein 4
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04510  Focal adhesion
ngi04650  Natural killer cell mediated cytotoxicity
ngi04722  Neurotrophin signaling pathway
ngi04910  Insulin signaling pathway
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04926  Relaxin signaling pathway
ngi04935  Growth hormone synthesis, secretion and action
ngi05034  Alcoholism
ngi05100  Bacterial invasion of epithelial cells
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05220  Chronic myeloid leukemia
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103733036 (Shc4)
   04014 Ras signaling pathway
    103733036 (Shc4)
   04072 Phospholipase D signaling pathway
    103733036 (Shc4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103733036 (Shc4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103733036 (Shc4)
   04062 Chemokine signaling pathway
    103733036 (Shc4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103733036 (Shc4)
   04915 Estrogen signaling pathway
    103733036 (Shc4)
   04917 Prolactin signaling pathway
    103733036 (Shc4)
   04926 Relaxin signaling pathway
    103733036 (Shc4)
   04935 Growth hormone synthesis, secretion and action
    103733036 (Shc4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103733036 (Shc4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103733036 (Shc4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103733036 (Shc4)
   05226 Gastric cancer
    103733036 (Shc4)
   05214 Glioma
    103733036 (Shc4)
   05220 Chronic myeloid leukemia
    103733036 (Shc4)
   05224 Breast cancer
    103733036 (Shc4)
  09165 Substance dependence
   05034 Alcoholism
    103733036 (Shc4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103733036 (Shc4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103733036 (Shc4)
   01522 Endocrine resistance
    103733036 (Shc4)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 103733036
NCBI-ProteinID: XP_008830007
LinkDB
Position
Un
AA seq 617 aa
MRERGQDSLAGLALYVGLFGHPGMLHRAKYSRFRNESITSLDEGSPGSSGASKSSPPAPY
PSLAPHLPAEDATVPPHESPTPLCTLIPRMTSMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDQLPSSSASPETSLSRTGPAPTLHPDQVGYRVTPLPPDCPLPGPREPTLRSRADRHF
LQHLLGTGMNFCVRYMGSIEVLKSMRSLDFGMRTQVTREAISRLCEAVPGASGGIKKRKA
PVKFLSTVLGKSNLQFSGVNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDTT
DYVAYVAKDPVNQRACHILECYHGKAQDIISAIGQAFELRFKQYLKNPSLNPCESEEVHP
DGPAEERDHDYYNAIPGKQPPVGGISDVRIKVQATEQMAYCPIRCEKLCYLPGNSRRSSE
YENCVEQSRALGISQVRGMQSSRVDLFDDPCYINTQVFHSTLDCAGNESSVQPQRSPWHC
GKAPKTVQPGAAAQPSSSHSLPHIKQQLWSEECYHGKLSRRAAERLLVKDGDFLVRESTS
SPGQYVLSGLQGGRAKHLLLVDPEGKVRTKDHVFDDVGHLIRYHMDNSLPIISSVSEVNL
KQPVRKDNNPGLSHSKK
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgcgagaacgcggccaggacagtctggcaggactcgctctgtatgtaggactctttggg
caccccgggatgctgcacagggccaagtacagccgctttcggaacgagtccatcacgtct
ttggacgaaggcagcccaggaagctcgggtgcaagtaagagttcgccgcctgctccctac
ccgtcgctggctcctcacctgccggctgaagatgccacggtgcctccccacgagagcccc
accccgctatgcaccttgatcccccgcatgaccagcatgaagctggccaacccagccact
ttgctgagtctgaaaaacttttgcctgggtaccaaagaggtgccccgtctgaaactccaa
gagagccaggaccagcttcccagcagctcggcttcccctgaaaccagtctaagtaggacc
gggcctgcacctacactgcatccagaccaggtggggtacagggtcacccccttgcctcct
gactgtccactgcctggccctagagagccaaccctcagaagcagagcagacaggcacttt
ctgcagcacctgttggggaccggcatgaacttctgtgtgaggtacatgggctccattgaa
gtgctgaaatcaatgaggtcactggattttggaatgagaacccaagttacaagggaagca
ataagccggttgtgtgaagctgtccctggggcgagtggaggcattaaaaaacgaaaggct
ccagttaagttcctatcaacagttcttggcaaaagtaatcttcagttttcaggagtgaat
ataaagctgaccatttcaacatgcagcctcacactgatgaatcttgacaaccaacagatt
attgcaaatcatcatatgcaatctatttcatttgcctctggaggggatcctgataccaca
gactatgttgcctacgtagctaaagacccagtcaatcaacgagcctgccacatattggaa
tgctaccatggaaaggcccaagatatcataagtgccatagggcaggcttttgaactccgg
tttaaacagtacttgaaaaatccttccttgaatccttgtgaaagcgaggaggtgcatcct
gatggcccagctgaggagagagatcatgactattacaatgcaatcccagggaagcagccg
ccagtaggcggcatctcagacgtgcggatcaaggttcaagctacagaacaaatggcttac
tgccctatacggtgtgaaaagttgtgctatttacccgggaactccaggcgcagcagcgaa
tatgagaactgtgtggaacaaagcagggcactaggtatttcccaggtgagagggatgcag
tcctctcgagtggatctctttgatgacccctgctacattaacacacaggtgtttcacagt
acacttgactgtgctggaaatgaaagctcagttcagccacagaggagcccatggcattgt
ggaaaggcaccaaaaactgtccagccaggtgctgccgcccagccttccagctcacactct
ttgccacacattaagcagcagctgtggagtgaagaatgctaccatggcaagctgagcagg
agggcagcagagaggcttttggttaaggatggggactttttggttcgagagagcacatca
tctcctggccagtatgtactgagtggactacaaggtggccgggcaaagcatcttctcttg
gtggatcctgaaggcaaggtgaggaccaaggatcatgtatttgatgatgttggccacctt
atcagataccatatggataacagtctgccaatcatctcctctgtaagtgaagtaaacctt
aagcaaccagtaagaaaggataataacccaggactttcacactccaagaaatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737407
Entry
103737407         CDS       T03372                                 

Gene name
Shc2
Definition
(RefSeq) SHC adaptor protein 2
  KO
K17447  SHC-transforming protein 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04370  VEGF signaling pathway
ngi04510  Focal adhesion
ngi04650  Natural killer cell mediated cytotoxicity
ngi04722  Neurotrophin signaling pathway
ngi04910  Insulin signaling pathway
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04926  Relaxin signaling pathway
ngi04935  Growth hormone synthesis, secretion and action
ngi05034  Alcoholism
ngi05100  Bacterial invasion of epithelial cells
ngi05214  Glioma
ngi05220  Chronic myeloid leukemia
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103737407 (Shc2)
   04014 Ras signaling pathway
    103737407 (Shc2)
   04370 VEGF signaling pathway
    103737407 (Shc2)
   04072 Phospholipase D signaling pathway
    103737407 (Shc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103737407 (Shc2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103737407 (Shc2)
   04062 Chemokine signaling pathway
    103737407 (Shc2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103737407 (Shc2)
   04915 Estrogen signaling pathway
    103737407 (Shc2)
   04917 Prolactin signaling pathway
    103737407 (Shc2)
   04926 Relaxin signaling pathway
    103737407 (Shc2)
   04935 Growth hormone synthesis, secretion and action
    103737407 (Shc2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103737407 (Shc2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103737407 (Shc2)
   05226 Gastric cancer
    103737407 (Shc2)
   05214 Glioma
    103737407 (Shc2)
   05220 Chronic myeloid leukemia
    103737407 (Shc2)
   05224 Breast cancer
    103737407 (Shc2)
  09165 Substance dependence
   05034 Alcoholism
    103737407 (Shc2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103737407 (Shc2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103737407 (Shc2)
   01522 Endocrine resistance
    103737407 (Shc2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 103737407
NCBI-ProteinID: XP_017654589
LinkDB
Position
Un
AA seq 540 aa
MARGHGKPDPLLSLVFLTDLGVQPGVPALAAVLGACEPRCTAPCPLPALGRCRGSGTRGA
RGNPDSADEWARKGGFIHKPAHGWLHPDARVLGPGVSYIVRYMGCIEVLRSMRSLDFNTR
TQVTREAINRLHEAVPGVRGSWKRKAPNKALATILGKSNLRFAGMSISVNISVDGLNLSV
PATRQIIANHHMQSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSVISTVG
QAFELRFKQYLHSPPKAVVPPERLTGLEESAWGDEDEAADHNYYNSIPGKEPPLGGLVDS
RLAVTQPCALAALGGFGQGMSPARRDARGLPWDVGPSGAAPPGDGYMQADARGPQDYEEH
LYVNTQGLDPAEREDVAEEPPLLDDSPKKDLFDMRPFEDALKLHECSVAGAITAAAPPLE
DQWPSPPTRRAPIAPTEEQLRQEPWYHGRMSRRAAEKLLRADGDFLVRDSITNPGQYVLT
GMQAGQPKHLLLVDPEGVVRTKDVLFESISHLVDYHLRNGQPIVAAESELHLRGVVSREP
NT seq 1623 nt   +upstreamnt  +downstreamnt
atggctagagggcacgggaagccggacccccttctgagccttgttttcctcacagatcta
ggggtgcagcccggggtccccgcgctggccgccgtcctgggcgcctgcgagccgcgctgc
accgcgccgtgtccgctgcccgcgctcggccgctgccggggctccgggacgcggggagca
cggggcaaccccgattccgccgacgagtgggcgcgcaagggcggcttcatccacaagccg
gcgcacggctggctgcaccccgatgccagggtcctggggccaggggtctcctacatcgtt
cggtacatgggatgtattgaggttctacgctccatgcgctcactggatttcaacaccaga
acacaggtgaccagggaagccatcaataggctccatgaggcagtgccaggggtccgaggc
tcctggaagaggaaggcccccaacaaagctctggccaccatcctggggaagagcaacctg
cggtttgcaggtatgagcatttctgtcaacatctctgtggatggcctcaacctgtcagtg
cctgctacgcgccagatcatcgccaaccatcatatgcagtccatctcctttgcttctgga
ggtgatacggacatgactgattacgtggcatatgtggccaaggaccccatcaatcagaga
gcttgtcacatcttggaatgctgtgagggtctcgcccagagcgtcatcagcaccgtgggc
caagcctttgagctgcgcttcaaacaatacctgcacagtccccccaaggccgtcgtaccc
ccagaaaggttgactggactggaggagtcagcctggggggatgaagatgaagctgctgac
cacaactactacaacagcatcccagggaaggagccacccctgggaggcctggtggactcc
agactggctgtcacacagccctgtgcactggcggcacttgggggatttggacagggaatg
tcacctgcacggagagatgcccgtggcctgccctgggacgtgggcccctctggtgcagcc
ccgccaggggatggctacatgcaggcggatgcccggggcccacaggactatgaggaacat
ctgtacgtcaacacccagggcctggaccccgcggaacgtgaggatgtggctgaggaaccc
ccactcctggatgacagccccaagaaggatctgttcgacatgcgcccctttgaagatgcc
ctgaagctgcatgagtgctcggtggcaggggccatcacggcggccgcaccccctctggag
gaccagtggcccagcccccccacccgccgggcccccatcgcccccacggaggagcagctg
aggcaggagccctggtaccacggacgcatgagccgccgggcggctgagaagctgcttcga
gctgatggggacttcctcgtgcgagacagcatcaccaaccccgggcagtacgtgctcacc
ggcatgcaggcgggccagcccaagcacctgctgctggtggaccccgagggcgtggtgcgc
acgaaggacgtgttgtttgagagcatcagtcacctcgtggattaccacctgaggaatggg
cagcccatcgtggccgctgagagtgagctacacctgcggggtgtggtctcccgggagccc
tga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751254
Entry
103751254         CDS       T03372                                 

Gene name
Shc1
Definition
(RefSeq) SHC adaptor protein 1
  KO
K06279  SHC-transforming protein 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04510  Focal adhesion
ngi04650  Natural killer cell mediated cytotoxicity
ngi04722  Neurotrophin signaling pathway
ngi04910  Insulin signaling pathway
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04926  Relaxin signaling pathway
ngi04935  Growth hormone synthesis, secretion and action
ngi05034  Alcoholism
ngi05100  Bacterial invasion of epithelial cells
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05220  Chronic myeloid leukemia
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103751254 (Shc1)
   04014 Ras signaling pathway
    103751254 (Shc1)
   04072 Phospholipase D signaling pathway
    103751254 (Shc1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103751254 (Shc1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103751254 (Shc1)
   04062 Chemokine signaling pathway
    103751254 (Shc1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103751254 (Shc1)
   04915 Estrogen signaling pathway
    103751254 (Shc1)
   04917 Prolactin signaling pathway
    103751254 (Shc1)
   04926 Relaxin signaling pathway
    103751254 (Shc1)
   04935 Growth hormone synthesis, secretion and action
    103751254 (Shc1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103751254 (Shc1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103751254 (Shc1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103751254 (Shc1)
   05226 Gastric cancer
    103751254 (Shc1)
   05214 Glioma
    103751254 (Shc1)
   05220 Chronic myeloid leukemia
    103751254 (Shc1)
   05224 Breast cancer
    103751254 (Shc1)
  09165 Substance dependence
   05034 Alcoholism
    103751254 (Shc1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103751254 (Shc1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103751254 (Shc1)
   01522 Endocrine resistance
    103751254 (Shc1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 103751254
NCBI-ProteinID: XP_008852870
LinkDB
Position
Un
AA seq 584 aa
MDLLPPKLKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPTLPGNDSPTTLCS
FFPRMSNLKLANPAGGRLGPKGEPGKAAENGEGVAGAAGRDSGLLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCNRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMASDCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEDEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAASGAVRPTLPSAQMPSHLGATLPVGQPTVGDSEVRKQILPPPPCPAGR
ELFDDPSYVNIQNLDKARQAGGGAGPPSLAVNGSTPRDLFDMKPFEDALRVPQPSQSMSM
AEQLQGESWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPE
GVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggatcttctacctcccaagctgaagtacaacccacttcgaaatgagtctctgtcatcg
ctggaggagggggcttcagggtccactcccccggaggagctgccttccccatcagcctca
tccctgggacccattctgccaactctgcctgggaacgatagtccgactaccctgtgctcc
ttctttccccgaatgagcaacctcaagctggccaatcctgctggggggcgcctggggcct
aagggggagccaggaaaagccgctgaaaatggggaaggggttgctggggcagctgggcgg
gactcaggcctcctgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtagaagggggccagctggggggcgaggagtggaccagacacgggagcttt
gtcaataagcccacgcggggctggctgcatcccaacgacaaagtcatgggacctggggtt
tcctatttggttcggtacatgggttgtgtggaggttctgcagtcaatgcgagcccttgac
ttcaatacccggactcaggtcaccagggaggccatcagtttggtgtgtgaggccgtgccg
ggtgccaagggggcgacaaggaggagaaagccctgtaaccgcccactcagctctatcctg
gggaggagtaacctgaagttcgctggaatgccaatcactctcactgtgtccaccagcagc
cttaacctcatggcctcagactgcaagcagatcattgccaaccatcacatgcaatctatc
tcatttgcgtccggtggggatccggacacagccgagtatgtcgcctatgttgccaaagac
cctgtgaatcagagagcctgccacatcctggagtgtcctgaagggcttgcccaggacgtc
atcagcaccattggtcaggcctttgaattgcgcttcaaacaatacctcaggaaccctccc
aagctggtcacccctcatgacaggatggctggctttgatggctcagcttgggatgaggaa
gaagacgaaccacccgaccatcagtactataatgacttcccaggaaaggaaccccctctt
ggtggggtggtagacatgaggcttcgggaaggagctgcttcaggagctgttcgacccact
ctgcccagtgcccagatgcccagccatctgggagctacactgcctgtagggcaaccaact
gtaggagactccgaagtccgaaaacagattcttcctccaccaccctgcccagcaggcaga
gaactttttgatgatccctcctatgtcaacatccagaacctagacaaagcccggcaagct
gggggcggggctgggccccccagtcttgctgtcaatggcagcacaccccgagaccttttt
gacatgaagccctttgaagatgcccttcgggtgcctcaaccttctcagtctatgtccatg
gctgagcaacttcaaggggagtcctggttccatgggaagctgagccggcgggaggcagag
gcactgctgcagctcaatggtgacttcttggtgcgagagagcaccactacacctggccag
tatgtgctcactggcctgcagagtgggcagcccaagcacctgcttctggtggaccctgag
ggtgtggttcggacaaaggatcaccgctttgagagtgtcagtcacctcatcagctatcac
atggacaatcatttgcccatcatctctgcaggcagtgaactatgtctacagcaacctgtg
gagcggaaactgtga

DBGET integrated database retrieval system