KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726417
Entry
103726417         CDS       T03372                                 

Definition
(RefSeq) cardiotrophin-2
  KO
K24382  cardiotrophin 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103726417
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103726417
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103726417
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103726417
SSDB
Motif
Pfam: PRF CNTF LIF_OSM
Other DBs
NCBI-GeneID: 103726417
NCBI-ProteinID: XP_008822198
LinkDB
Position
Un
AA seq 218 aa
MRDYVGGEGPRQKQTREEGRAPLCLLSLLLPPLSPAAPISPSEPISQAYSLALYMQKNTS
TLLQTYLQYQGSPFSDPGFSAPELQLSSLPPAAVSFKIWHAMDDAERLNRVQEAFLALTQ
HLQLVGDDQSDLNPGSPILLTQLGAARLRAQGLMGNMAAIMTALGLPIPPEEDTLGLVPF
GASTFERKCRGYIVTREYGHWTDRAVRDLALLKAKYPA
NT seq 657 nt   +upstreamnt  +downstreamnt
atgagggactatgtggggggagaggggcccaggcagaaacagaccagggaagaagggaga
gcccctctctgcctactgagcctgttgctgccacccctcagtcctgcagcccccatctcc
ccatcagagcccatcagtcaagcctatagtctggccctctatatgcagaagaacacctcg
acattgctacagacgtatctccagtaccagggcagcccctttagtgaccctggcttttca
gcacctgagctccagctcagcagcctgccccctgctgcagtctccttcaagatctggcat
gcaatggatgatgcagagcggctaaaccgtgtccaggaagccttcctggccttgacccag
cacctccagcttgtgggggatgatcagagtgacctgaaccctggcagtcctatcctgctg
acccagctaggagctgcaagactcagggcccaaggcctgatgggcaacatggctgctatc
atgactgccctggggctgcctatccccccagaagaggatactctggggcttgttcctttt
ggagcctccacctttgagaggaaatgcagaggctacatagtgacccgggaatacggtcac
tggacagatcgggctgtgagggacttggctctactcaaggccaaatatccagcttag

DBGET integrated database retrieval system