KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726473
Entry
103726473         CDS       T03372                                 

Gene name
Kitlg
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04916  Melanogenesis
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103726473 (Kitlg)
   04014 Ras signaling pathway
    103726473 (Kitlg)
   04015 Rap1 signaling pathway
    103726473 (Kitlg)
   04072 Phospholipase D signaling pathway
    103726473 (Kitlg)
   04151 PI3K-Akt signaling pathway
    103726473 (Kitlg)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103726473 (Kitlg)
  09152 Endocrine system
   04916 Melanogenesis
    103726473 (Kitlg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103726473 (Kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103726473 (Kitlg)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103726473 (Kitlg)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 103726473
NCBI-ProteinID: XP_008822285
LinkDB
Position
Un
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVTG
MDVLPSHCWLREMVIQLSVSLTNLLDKFSNISEGLSNYSIIDKLGKIVDDLVECVEENAP
KNVMKEPLKRPEPRLFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKAAKSAGDSDLQWAAMALPALISLVIGFAFGALYWKK
KQSNLTRAVETIQINEEDNEISMLQQKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtcaaaactaaagagatctgtgggaatcctgtgactgataatgtaaaagacatc
acaaaattggtggcaaatctcccaaatgattatatgataaccctcaactatgtcaccggg
atggacgttttgcctagtcattgttggttacgtgagatggtaatacagttgtcagtcagc
ttgactaatcttctggacaaattttcaaatatttctgaaggcttgagtaattattcaatc
atagacaaacttgggaaaattgtggatgaccttgtggaatgtgtggaagaaaacgcacct
aagaatgtaatgaaagaaccattgaagaggccagaacccaggctcttcactcctgaagaa
ttctttagtattttcaatagatccattgatgcctttaaagactttatggtggcatctgac
actagcgattgtgtgctttcctcgacattaagtcctgagaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggccgcaaagtctgctggagactcagacctacaatgggcagccatggca
ttgccagcactcatttctcttgtaattggctttgcttttggagccttatactggaagaag
aaacaatcaaatcttacaagggcagttgaaactatacagattaatgaagaggataatgag
ataagtatgttgcaacaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system