KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726651Help
Entry
103726651         CDS       T03372                                 

Gene name
Ptgs2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00590  Arachidonic acid metabolism
ngi01100  Metabolic pathways
ngi04064  NF-kappa B signaling pathway
ngi04370  VEGF signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04657  IL-17 signaling pathway
ngi04668  TNF signaling pathway
ngi04723  Retrograde endocannabinoid signaling
ngi04726  Serotonergic synapse
ngi04913  Ovarian steroidogenesis
ngi04921  Oxytocin signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi05140  Leishmaniasis
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05200  Pathways in cancer
ngi05204  Chemical carcinogenesis
ngi05206  MicroRNAs in cancer
ngi05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103726651 (Ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103726651 (Ptgs2)
   04064 NF-kappa B signaling pathway
    103726651 (Ptgs2)
   04668 TNF signaling pathway
    103726651 (Ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103726651 (Ptgs2)
   04657 IL-17 signaling pathway
    103726651 (Ptgs2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103726651 (Ptgs2)
   04913 Ovarian steroidogenesis
    103726651 (Ptgs2)
   04921 Oxytocin signaling pathway
    103726651 (Ptgs2)
  09156 Nervous system
   04726 Serotonergic synapse
    103726651 (Ptgs2)
   04723 Retrograde endocannabinoid signaling
    103726651 (Ptgs2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    103726651 (Ptgs2)
   05206 MicroRNAs in cancer
    103726651 (Ptgs2)
   05204 Chemical carcinogenesis
    103726651 (Ptgs2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    103726651 (Ptgs2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    103726651 (Ptgs2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103726651 (Ptgs2)
   05165 Human papillomavirus infection
    103726651 (Ptgs2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    103726651 (Ptgs2)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103726651 (Ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 103726651
NCBI-ProteinID: XP_008822484
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLLRALLLCATVALSHAANPCCSNPCQNRGECMSVGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRNSIMKYVLTSRSHLIDSPPTYNVHY
GYKNWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKEVLQKVLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDQKRGPAFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKY
QVIDGEVYPPTVKDTQVEMMYPPHTPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLRQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFHIEDQEYNFKQFLYNNSILIEHGLAQFVESFTRQNAGRV
AGGRNVPLAVEAVAKASIDQSRQMKYQPLNEYRKRFSLKPYASFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPHYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTSFSVQDPQPTKTATINASASHSRLDDINPTVLIKRR
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcctccgcgccctgctgctctgcgctacggtggcgctcagccacgcagcaaatcct
tgctgttccaacccatgtcaaaaccgaggtgaatgtatgagcgtaggatttgaccagtat
aagtgtgattgtacacggacaggattctatggagaaaattgtacaacccctgagtttctg
acaagaataaaattactgctgaagcccaccccaaacacagtgcattacatattgacccac
ttcaagggagtctggaacattgtgaataacattcccttcctgagaaattcaatcatgaaa
tatgtgctgacatccagatcacatttgattgacagtccaccaacttataatgtgcattat
ggctacaaaaactgggaagccttctctaacctctcctactacaccagagcccttcctcct
gtagcagatgactgtccaactcccatgggtgtgaaaggaaagaaggaacttcctgattca
aaagaagttctgcaaaaagttcttttaagaagaaagttcatccccgatccccaaggcaca
aacatgatgttcgcattctttgcccagcatttcacgcatcagttttttaagacagaccag
aaacgaggtcctgccttcacccggggactgggtcatggggtggacttaaatcatatttat
ggtgaaactctagacagacaacataaactgcgtcttttcaaggatggaaaattaaaatat
caggttattgatggagaggtgtatcctcccacagtcaaagatactcaggtggagatgatg
tacccacctcatacccctgagcacctgcgctttgccgtggggcaggaggtctttggtctg
gtgcctggtttgatgatgtatgccaccatctggcttcgggagcataacagagtgtgtgat
gtgctcagacaagagcatcctgagtgggatgatgagcggctattccagacaagcagactc
atcctgataggagagacaatcaagattgtgattgaggactacgtgcagcatttaagtggt
tatcacttcaaactgaagtttgacccagagctgcttttcaaccagcagttccagtaccag
aaccgcattgccgctgagttcaacacactctaccactggcatcccctgctgcctgacacc
tttcacattgaagaccaggagtacaactttaaacagtttctctacaacaactctatactg
atagaacatggacttgcccagttcgttgaatcattcaccaggcaaaatgctggccgggtt
gctggtggtaggaacgtcccacttgcagtagaagcagtggcaaaggcctccattgaccag
agcagacagatgaagtaccagcctctcaatgagtaccgcaaacgcttctccctgaagccc
tatgcatcttttgaagaacttacaggagagaaggaaatggctgcagagttggaggctctc
tatggtgacattgatgctatggagctgtaccctgcccttctggtagaaaagcctcgccca
gatgctatctttggggagaccatggtagaacttggagcaccattctccttgaaaggactt
atgggtaatcctatctgttctcctcactactggaagccaagcacttttgggggagaagta
ggttttaagatcatcaacactgcctcgattcagtctctcatctgcaataacgtgaagggc
tgcccctttacttcattcagtgttcaagatccacagccaactaaaacagccaccatcaac
gcaagtgcctcccactccagactagatgacatcaaccccacagtgctaatcaaaaggcgt
tcgactgaactgtag

DBGET integrated database retrieval system