KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726654
Entry
103726654         CDS       T03372                                 

Gene name
Tpr
Definition
(RefSeq) translocated promoter region, nuclear basket protein
  KO
K09291  nucleoprotein TPR
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi03013  RNA transport
ngi05014  Amyotrophic lateral sclerosis
ngi05200  Pathways in cancer
ngi05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    103726654 (Tpr)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103726654 (Tpr)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103726654 (Tpr)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103726654 (Tpr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ngi03019]
    103726654 (Tpr)
Messenger RNA biogenesis [BR:ngi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     103726654 (Tpr)
SSDB
Motif
Pfam: TPR_MLP1_2 DUF1192 DUF5082
Other DBs
NCBI-GeneID: 103726654
NCBI-ProteinID: XP_008822489
LinkDB
Position
Un
AA seq 2421 aa
MASRGLEGYRRGSLRRAGTREPASEAAEAPAHPPECWPSPCSFVSTPSAAPAAASGPADM
AAVLQQVLERPELNKLPKSTQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKRL
SQSQERLVNETRECQNLRLDLEKLNNQLKILTEKNKELETAQDRNIGIQNQFTRAKEELE
AEKRDLIRTNERLSQEVEYLTEDVKRLNEKLKESNTTKGELQLKLDELQASDVSVKYREK
RLEQEKELLHSQNTWLNTELKTKTDELLALGREKGNEILELKCSLENKKEEVSRLEEQMN
GLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKSN
ELTRAVDELHKLLKEAGEVNKTIQDHLLQVEETKDQMEKEMLEKIGKLEKELENANDLLS
ATKRKGAVLSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVEAQDQLLLEKLENKRINK
YLDEIVKEVEAKAPILKRQREEYERAQKAVASLSAKLEQAMKEIQRFQEDTDKANKHSSI
LERDNQRMEVQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSYR
NIEELQQQNQRLLFALRELGETREREEQETTSSKITELQHKLESSLSELEQLRDARKHQM
QLVDSIVRQRDMYRILLTQTTGMAIPLQASSLEDVSLVSTPKRSSTSQTVSTPAPVPVIE
STEAIEAKAALKQLQEIFENYKKEKMDSEKIQNDQLEKLQEQVTDLRSQNTKISTQLDFA
SKRYEMLQDNVEGYRREITSLQERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVRA
ENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLSSQI
EKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTEINLHLNTKELLKNAQKEI
ATLKQHLSNMEAQLASQSTQRTGKGQPNDKEDVDDLRSQLRQAEEQVSDLKERLKTSASN
VEQYRAMVTSLEDSLNKEKQVTEEVHKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDD
KRKAIESMEQQLSELKKTLSSVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNK
YERELMLHAADVEALQAAKEQVSKMASVRQHLEESTEKAESRLLECRASWEERERMLKDE
VSKSVSRCEDLEKQNRLLHDQIEKLSDKVVASMKEGVQGPLNVSLSEEGKSQEQILEILR
FIRREKEIAETRFEVAQVESLRYRQRVELLEREMQELQDSLNAEREKVQVTAKTMAQHEE
LMKKTETMNVVMETNKILREEKERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGML
QAEKKLLEEDVKRWKARNQHLVNQQKDPDTEEYRKLLSEKEIHTKRIQQLNEEIGRLKAE
IARSNASLTNNQNLIQSLKEDLNKVRTEKENTQKDLDAKIIDIQEKIKTITQVKKIGRRY
KTQYEELKAQQDKAMETSAQSSGDHQEQHVSIQEMQELKDALSQAETKSKSLESQVENLQ
KALSEKETEARNLQEQTVQLQSELSRLRQDLQDRTTQEEQLRQQITEKEEKTRKAIVAAK
SKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRMTALKSQYEGRISRLERELREHQ
ERHLEQRDEPQEPTNKAPEQQRQITLKTTPASGERGIASTSDPPTANIKPTPVVSTPSKV
TAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVESQEAMQSEGPVEHVPVF
GSTSGSVRSTSPNVQPSISQPILTVQQQTQATAFVQPTQQSHPQIEPANQELSPNIVEVV
QSSPVERPSTSTAVFGTVSATPSSSLPKRTRDEEEDSTIEASEQVSDDTVEMPLPKKLKT
VTPVGTEEEVMAEESTDGEVETQVYNQDSQDSIGEGVTQGDYTPMEDSEETSQSLQIDLG
PLQSDQQTTSSQDGQGKGDDVIVIDSDDEEDDDDENDGEHEDYEEDEEDDEDDEDDTGMG
EEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGGESNQRAADSQNSGEGNA
SAAESSFSQEVSREQQPTSASERQTPRAPQSPRRPPHPLPPRLTIHAPPQELGPPVQRIQ
MTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPHRTDGFAEAIHSPQVAGVP
RFRFGPPEDMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEESGGRSVPTTPLQVAAPV
TVFTESTTSDASEHASQSVPMVTTSTGTLSTTNETATGDDGDEVFVEAESEGISSEAGLE
IDSQQEEEHVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFRRVRLQTTLRQGVRGRQFN
RQRGVSHAMGGRGGINRGNIN
NT seq 7266 nt   +upstreamnt  +downstreamnt
atggcatcccggggcttggaagggtaccgtcgcgggagtctccggcgggccggcacgcgg
gagccagcgagcgaggctgcggaggcgccggctcaccccccagagtgctggccttcgcct
tgctccttcgtttctaccccttcggccgctcctgccgcggcctctggcccagcagacatg
gcggcggtgttacagcaagtactggagcggccggagctgaacaagctgcctaagtctacc
cagaacaaacttgagaagttcctggctgatcaacagtcggagatcgatggcctgaaaggg
cggcacgagaagtttaaggtggagagcgaacaacagtactttgagatagagaagaggctg
tctcagagccaagagaggctggtgaatgaaactcgagagtgccagaatttgcgactagac
cttgaaaagctcaataatcaactgaaaatactaactgagaaaaacaaagaacttgaaact
gcccaagatcgcaatattggcattcagaaccagtttacaagagcaaaggaagaattagaa
gctgaaaaacgagacttaatcagaaccaatgagagactctctcaggaagttgaatattta
acagaggatgtcaaacgtctaaatgaaaagcttaaagaaagcaatacaacaaagggtgaa
cttcagttaaagttggacgaacttcaagcttctgatgtgtctgtgaagtatcgcgagaaa
cgcttagagcaagaaaaagaattgctgcatagtcagaatacatggctcaatacagagttg
aaaaccaaaactgatgagctgttggctctcggaagagaaaaaggaaatgagattctagaa
cttaaatgtagtcttgaaaacaaaaaagaagaggtttcaagactggaagaacagatgaat
ggcttaaaaacatcaaatgaacaccttcaaaaacatgtagaggatttgttgactaaatta
aaagaggccaaagaacagcaagccagtatggaagagaaattccataatgaattaaatgct
cacataaagctctctaatctatacaagagtgctgctgatgactcggaggcaaagagcaat
gaactaactcgggctgtggatgaactacacaaacttctgaaagaagctggagaagtgaac
aaaacaatacaagatcatcttctgcaagtggaagaaactaaagatcaaatggaaaaagaa
atgcttgagaaaatagggaagctagaaaaggaattagagaatgccaatgacctgctttct
gccacaaaacgcaaaggagctgtattatctgaggaagagctggcagccatgtctcccact
gcagcagctgtcgcgaagatagtgaaacctggcatgaagttaaccgagttatataatgct
tatgtcgaagctcaggatcagttgcttttggaaaaactagaaaataaaagaattaataag
tatctagatgaaattgtaaaagaagttgaagccaaagctccgattttgaaacgccaacgt
gaagagtatgaacgtgcacagaaggctgtggcaagtttatcggccaagctggaacaagct
atgaaggagattcagcgattccaggaggacactgacaaagccaacaagcattcgtccata
ctggaaagagacaatcagaggatggaagttcaaataaaagatctttcacaacagattaga
gtgcttttgatggaacttgaagaagcaaggggtaaccatgttatccgggatgaggaagtg
agctctgctgacataagtagttcatctgaagtaatctcacagcacctagtatcttaccga
aatattgaagagcttcagcagcaaaatcagcgtctgttatttgctcttcgagaacttggg
gaaaccagggaacgagaagaacaagaaacaacttcctctaaaatcactgagcttcagcac
aaacttgagagttccctcagtgaactggaacaactccgtgatgcacggaagcatcagatg
cagcttgttgattccatagttcgtcagcgtgacatgtaccgcattttattgacacaaaca
acaggaatggccattccattgcaagcttcaagcttggaagatgtttctcttgtatcaact
ccgaaacgttccagtacatctcagactgtttccacacctgcccctgtacctgttatagag
tcaacagaagctatagaagcaaaagctgccctcaaacagttgcaggaaatttttgagaac
tataaaaaggaaaaaatggacagtgaaaaaattcagaatgaccaacttgagaaacttcag
gagcaagtcacagatctgcgatcacagaacaccaaaatttctactcaactggattttgct
tctaaacgatacgaaatgcttcaagataatgttgaaggctatcgccgagaaataacttct
ctgcaagaaagaaatcaaaaactcactgcaacaactcaaaagcaggagcagatcatcaat
acgatgacacaagacttgagaggtgccaatgaaaagctagctgttgcagaggtaagagca
gaaaatctgaagaaggaaaaggagatgcttaaattgtcagaagtccgcctatctcagcaa
agagagtctttgttagctgagcagaggggacagaacctgctgctgactaatctgcaaaca
atccagggaatactagagcgatctgaaacagaaaccaaacaaagacttagtagccagata
gaaaaactggagcacgagatctctcatctgaagaagaagttggaaaatgaggtggaacaa
agacacacacttaccagaaatctagatgttcaacttttagatacaaagagacagttagat
acagagataaatcttcatcttaacacaaaagaactgttaaaaaatgctcagaaggaaatt
gctacactgaaacagcaccttagcaacatggaagcccaacttgcttctcagtccacacag
agaactggtaaaggtcagcctaatgacaaagaagatgttgatgatcttcggagtcagcta
aggcaggctgaagaacaggtcagtgacttgaaggagagacttaaaacaagtgcaagtaat
gtggagcagtatcgagctatggtgactagtttagaggactcgctgaacaaagaaaaacag
gtgacagaggaagtacataagaatattgaagttcgtttaaaagaatcagcggaatttcag
acacagttggaaaaaaagttgatggaagtagagaaggaaaaacaagaacttcaggatgac
aagagaaaagccatagagagcatggagcaacagttatctgaattgaagaagacactttct
agtgttcagaatgaagtacaggaagctcttcagagagcaagcacagctttaagtaatgaa
cagcaagccagacgtgactgtcaggaacaggctaaaatagctgtggaggctcagaataag
tatgagagagaactgatgctccatgctgctgatgttgaagccctgcaggctgccaaggaa
caagtttcaaaaatggcatcagtccgtcagcatttggaagaatctactgagaaagcagaa
tcacggttgttggagtgcagagcatcctgggaagaaagagagagaatgctaaaggatgaa
gtttctaagagtgtatctcgctgtgaagatctagagaaacaaaacagactacttcatgat
caaattgaaaaattaagtgataaggtagttgcctctatgaaggaaggtgtgcaaggccca
ttaaatgtgtctctcagtgaagaaggaaaatctcaagaacaaatattagaaattctcaga
tttatacgacgagaaaaagaaattgccgaaactaggtttgaggtggctcaggttgagagt
ctgcgttatcgacaaagggtggaacttctagaacgagagatgcaagagctgcaggatagc
ctgaatgctgaaagggagaaggtccaggtaactgcaaaaacaatggcacagcatgaagaa
ctgatgaagaaaactgaaacaatgaatgtagttatggagaccaataagatactaagagaa
gaaaaggagaggcttgagcaggacctgcaacagatgcaagcgaaggtgaggaaactggag
ttagatattttacccttgcaagaagcaaatgctgagctgagtgagaaaagtggtatgttg
caggcagagaagaagttactagaagaggatgtcaagcgatggaaagcacgcaaccagcat
ctggtaaatcaacagaaagatccagatacagaagaatatcggaaacttctttctgaaaag
gaaattcacactaagcgaattcaacagctaaatgaagagattgggagacttaaagctgaa
attgcaagatcaaatgcatctttgaccaacaaccagaatttaatccagagtctaaaggaa
gatttaaataaagttaggactgaaaaggaaaacactcagaaggatttagatgccaaaata
attgatatacaagaaaaaatcaaaaccattactcaagtcaagaaaattggacgcaggtac
aagactcaatatgaagagcttaaagcacaacaggataaggccatggagacttctgctcaa
tcttccggagaccatcaggagcagcatgtctctatccaggaaatgcaagagctcaaagat
gccctcagccaagctgaaactaaatccaagtcacttgagagtcaagtagagaatctgcag
aaggcattatctgaaaaagagacagaagcaagaaatctccaggaacagactgtgcagctt
caatctgaactttcacgacttcgtcaagatctgcaagatagaaccacacaagaagagcag
ctccgacagcagataactgaaaaggaagaaaaaaccaggaaggcgattgtagcagcaaaa
tcaaaaattgcacacctagctggtgtaaaagatcaattaactaaagaaaatgaagaacta
aaacagaggaacggagccttggatcagcagaaagatgaactagatgttcgtatgactgct
ctgaagtcccagtatgaaggtcggattagccgcttggaaagagaactcagggaacatcaa
gagagacaccttgaacagagagatgagcctcaggagcctactaacaaggctcctgaacag
cagagacagatcacgctgaaaacaactccagcttctggtgaaagaggaattgccagcaca
tcagacccaccaacagccaatatcaagccaactcctgttgtttctactccaagtaaagtg
acagccgcagctatggctggaaataagtcaacacccagagcaagtatccgcccaatggtt
acacctgcaactgttacaaatccaactactaccccaacagcaacagtgatgcctaccaca
caagtggaatctcaggaagcgatgcagtcagaagggcctgtggaacatgttccagtgttt
ggaagcacaagtggatctgttcgttctactagtcctaatgttcagccctccatttctcag
cccatcctaactgtgcaacagcagacacaggctacagcttttgtgcagcccactcaacag
agtcatcctcagattgagcctgcgaatcaagagttatccccaaacatagttgaggtggtg
caaagttcgcctgttgagcggccttctacttccacagcagtatttggcactgtttcagct
accccaagctcctctttgcccaagcgcactcgtgatgaggaagaggacagcaccatagaa
gcatcagaacaagtctcagatgacacagtggaaatgcctctcccgaagaagctgaaaact
gtcacacctgtaggaactgaggaagaagttatggctgaagaaagtactgatggagaggta
gagacgcaagtatataatcaggattctcaagattccattggagaaggagttacccaggga
gattatacacctatggaagacagtgaagaaacatcacaatctctacaaatagatcttgga
ccacttcaatcagatcagcaaactacttcatcccaggatggtcaaggcaaaggagatgat
gtaattgtaattgacagtgatgatgaagaagatgatgatgatgaaaatgatggagaacat
gaggattatgaggaagatgaagaagatgatgaggatgatgaagatgacacagggatggga
gaggagggtgaagatagtaatgaaggaactggtagtgcagatggtaatgatggatatgaa
gctgatgatgctgagggtggtgatgggactgatccgggtacagaaacagaagaaagtatg
ggtggaggtgaaagtaatcagagagctgctgattctcaaaacagtggagaaggaaatgca
agtgcagcagagtcatctttttctcaggaggtttctagagaacaacagcccacatcagca
tctgagagacagactccccgagcaccgcagtcgccaaggcgcccaccccatcctcttccc
ccacgcttgaccattcatgctccacctcaggaactgggaccaccagttcagagaattcag
atgacccggaggcagtctgtagggcgtggcctgcagttgactccaggtataggtggcatg
cagcagcatttttttgatgatgaagacagaacagtcccaagtaccccaactcttgtagta
ccacatcggactgatggatttgctgaagctatccattccccacaggttgctggtgttcct
agattccgatttgggccacctgaggacatgccacaaacaagctccagtcactctgatctt
ggccagcttgcttctcaaggaggtttaggaatgtatgaaacccccctcttcctagctcat
gaagaagagtctggtggccgcagtgttcctactacgcctctacaagtagcagctccagtg
accgtgtttactgagagtaccacctctgatgcttcagagcacgcctctcagtctgttcca
atggtgacaacgtccactggcactttatccacaacaaatgaaacagcaacaggtgatgat
ggagatgaagtgtttgtggaggcagaatctgaaggcattagttccgaagcaggcctagaa
attgatagccagcaggaagaagagcatgttcaagcatcagatgaatcagacctcccttct
accagccaggaccctccttccagctcttctgtagatactagtagtagtcagccaaagccc
ttcagacgagtaagacttcagacaacattgcgacaaggtgttcgtggtcgtcagtttaac
agacagagaggtgtaagccatgcaatgggaggaagaggaggaataaatagaggaaatatt
aattaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746345
Entry
103746345         CDS       T03372                                 

Gene name
Tfg
Definition
(RefSeq) TRK-fused gene
  KO
K09292  protein TFG
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi05200  Pathways in cancer
ngi05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746345 (Tfg)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103746345 (Tfg)
SSDB
Motif
Pfam: PB1
Other DBs
NCBI-GeneID: 103746345
NCBI-ProteinID: XP_008846703
LinkDB
Position
Un
AA seq 398 aa
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSTSIPENDNVDGREEKPAASDSSGKQSTQVMAASMSAFDPLKNQDEINK
NVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPAVQAQQPPYTGTQTQAGQI
EGQMYQQYQQQAGYSAQQAQAPPQQYGIQYSASYGQQTGPQQPQQFQGYGQQPTSQAPAP
AFSGQPQQLPAQPPQQYQASTYPPQTYTTQTSQPANYTVPPASQPGMAPSQPGAYQPRPG
FTPSPGSTMTQPSSGPNPYARNRPPFGQGYTQPGPGYR
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgaatggacagttggacctaagtgggaagctaattatcaaagctcaacttggggaggat
attcgacgaattcccattcataatgaagatattacttatgatgaattagtgctaatgatg
cagcgagttttcagaggaaaacttctgagtaatgatgaagttacaataaagtataaagat
gaagatggagatcttataacaatttttgatagttctgacctttcctttgcaatccagtgt
agtagaattctgaaattgacattatttgttaatggccagccaagaccccttgaatcaagt
caggtgaaatatcttcgtcgagaactgatagaacttcgaaataaagtgaatcgcttattg
gacagcttggaaccacctggagaaccaggaccttccaccagtattcctgaaaatgataat
gtggatggtagggaagaaaagcctgctgcttctgattcttctggaaaacagtctactcag
gtcatggcagcaagtatgtcagcttttgaccctctgaaaaaccaagatgaaatcaataaa
aatgtcatgtcagcatttggcttaacagatgatcaggtttcagggccacccagtgctcct
gcagaagaccgttcaggaacacctgacagcattgcttcttcctcctcagcagcacatcca
ccagcggttcaagctcagcagcctccatatacaggaactcagacacaagcaggtcagatt
gaaggtcagatgtatcaacagtaccagcagcaggctggctacagtgcacagcaggctcag
gctccacctcagcagtatggtattcagtattcagctagttacggccagcagactggaccc
cagcaacctcagcagttccagggatatggccaacaaccaacttctcaggcaccagctccc
gccttttctggtcagccacaacaactgcctgctcagccaccacagcaataccaggcgagc
acttaccctccacaaacttatactacccaaacatctcaacctgctaactatactgtgccc
cctgcctctcagcctggaatggctccaagccagcctggggcttatcaaccaagaccaggt
tttactccatctcctggaagtaccatgacccaaccttccagtgggcctaacccttatgca
cgtaaccgtcctccttttggtcagggctatactcaacctggacctggttatcgataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750263
Entry
103750263         CDS       T03372                                 

Gene name
Ntrk1
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 1
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04210  Apoptosis
ngi04722  Neurotrophin signaling pathway
ngi04750  Inflammatory mediator regulation of TRP channels
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05216  Thyroid cancer
ngi05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103750263 (Ntrk1)
   04014 Ras signaling pathway
    103750263 (Ntrk1)
   04020 Calcium signaling pathway
    103750263 (Ntrk1)
   04151 PI3K-Akt signaling pathway
    103750263 (Ntrk1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103750263 (Ntrk1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103750263 (Ntrk1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103750263 (Ntrk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103750263 (Ntrk1)
   05202 Transcriptional misregulation in cancer
    103750263 (Ntrk1)
   05230 Central carbon metabolism in cancer
    103750263 (Ntrk1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103750263 (Ntrk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103750263 (Ntrk1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103750263 (Ntrk1)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   103750263 (Ntrk1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase LRR_8 TPKR_C2 I-set Ig_3 Ig_2 TrkA_TMD LRR_4
Other DBs
NCBI-GeneID: 103750263
NCBI-ProteinID: XP_008851531
LinkDB
Position
Un
AA seq 798 aa
MLRGQRHQQQGWHRRAAGPAGLLPWLMLASACAAPCRETCCPISPSGLRCTEAGALDSLR
RLPGIENLTELYVENQPHLQRLEFGDLQGLGELRSLTIVKSGLSFVAPDAFHFTPRLSHL
NLSSNALESLSWKTVQGLSLQELVLSGNPLHCSCALYWLQHWEQEGLCAVHAQKLQSSKP
GDQLLPLRQNTSCGVPTLTVQMPNDSVEVGDNVLLQCQVEGQSLQQAGWTLTELEGTATV
TKSGDLPSLELTLINVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVHLSRAVEQHH
WCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTHFLESALTNETMRHGCLRLNQPTHVNNG
NYTLLAANPYGQASDSIMVAFMDNPFEFNPEDPIPVSFSPVDTNSTSRDPVEKDETPFGV
SVAVGLAISAALFLSALLLVLNKCGQRSKFGINRPAVLAPEDGLAMSLHFMTLGSSSLSP
TEGKGSGLQGHIMENPQYFSDACVHHIKRQDIVLKWELGEGAFGKVFLAECHNLLSEQDK
MLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRSLLMVFEYMRHGDLN
RFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAIASQVAAGMVYLASLHFVHRDLATRNCLV
GQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFSTESDVWSFGVVLW
EIFTYGKQPWYQLSNTEAIECITQGRELERPRACPPDVYAVMRGCWQREPHQRHNMKDVH
ARLLALAQAPPGYLDVLG
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgctgcgaggccagcggcaccagcagcagggctggcatcgccgggccgcggggcctgcc
ggcctgctgccttggctgatgctggcctctgcctgtgctgcaccctgccgcgagacctgc
tgccccataagcccctccgggctgcgttgcaccgaggctggggccctggatagcctccgc
cgcttaccgggcatcgagaacctgaccgagctctacgtggagaatcagccgcatctgcag
cgcctggagtttggggacctgcagggcctgggggagttgagaagcctcaccattgtgaag
agtggtctcagctttgtggctccagatgccttccatttcacccctcgactcagtcatctg
aacctgtcctccaatgctctggaatctctctcctggaaaacagtgcagggcctctcccta
caggagctggtcctgtcggggaacccactgcattgttcctgtgccctgtactggttgcag
cactgggaacaggaggggctatgtgctgtgcatgcacagaagctacagagctccaagcct
ggggatcagctcctcccactcaggcaaaacaccagctgtggtgtacccacgctgacggtc
cagatgcccaatgactctgtggaagtgggggacaatgtattgctgcagtgccaggtggag
gggcagagcctgcagcaggctggctggactctcacagagctggaggggacagccacagtg
acgaaatctggggatctgccatccctggagctgaccctgatcaatgtcaccagtgatctc
aacaggaagaatgtgacgtgctgggcagagaatgacgtgggccgagctgaggtttctgtc
caagtcaacgtctccttcccagctagtgtgcacctgagcagagcagtggagcaacatcac
tggtgcatacctttctccgtggatgggcagccagcaccctctctgcgctggctcttcaat
ggctctgtgctcaatgagacgagcttcatcttcactcatttcctggagtcagcactgacc
aatgagaccatgcggcatggctgcctccgcctgaaccagcccacccatgtcaacaatggg
aactacacgctgctggctgccaacccctatggccaggcctccgactccatcatggttgcc
ttcatggacaacccttttgagttcaaccctgaggatcccatccctgtctccttctcacca
gtggacactaatagcacatcaagagacccggtggagaaggatgaaacaccttttggggtc
tctgtggctgtgggcctggccatctctgctgcccttttcctttctgccctgctcctcgtg
ctcaacaaatgcggacagagaagcaagtttgggatcaaccgccctgctgtgctggctcca
gaagatgggctggccatgtccctacatttcatgacattgggtagcagctctctttctcct
actgagggcaaaggatccggactccagggccacatcatggagaacccacagtacttcagt
gatgcctgtgtccatcacatcaagcgccaggacattgtgctcaagtgggagctgggcgag
ggtgcctttgggaaggtcttcctcgccgaatgccacaacctgctgagtgaacaggacaag
atgctggtggctgtcaaggcacttaaggaggcatcagagagcgccaggcaggacttccag
cgtgaggctgagctgctcaccatgctacagcaccagcacattgtgcgcttctttggagtt
tgcaccgagggccgctcgctgctcatggtctttgagtacatgcgccacggggacctcaac
cgcttccttcggtcacatgggcctgatgcgaagttgctggctggaggggaggatgtggct
cccggtcctctgggccttgggcagctgctggctattgctagccaggtggctgcaggcatg
gtatacctggctagcctgcactttgtgcaccgggacctggccacacgcaactgtctagtg
ggtcagggactagtggtcaagatcggggacttcggcatgagcagggacatctacagcaca
gactattaccgggtgggaggtcggaccatgctgcccatccgctggatgcccccagagagc
atcctctaccgcaagtttagcactgagagcgatgtgtggagcttcggggtagtactctgg
gagatcttcacctatggaaagcagccctggtaccagctctccaacactgaggcgatcgaa
tgcatcacgcagggccgtgagctggagcggccccgtgcctgccctccggacgtctatgcg
gtcatgcgaggctgctggcagcgtgagccgcatcagcgacacaacatgaaagacgtgcac
gcgcggctgctggccctggcgcaggcaccaccgggatacctggacgtcctgggctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751563
Entry
103751563         CDS       T03372                                 

Gene name
Tpm3
Definition
(RefSeq) tropomyosin 3
  KO
K09290  tropomyosin 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04260  Cardiac muscle contraction
ngi04261  Adrenergic signaling in cardiomyocytes
ngi05200  Pathways in cancer
ngi05216  Thyroid cancer
ngi05410  Hypertrophic cardiomyopathy
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103751563 (Tpm3)
   04261 Adrenergic signaling in cardiomyocytes
    103751563 (Tpm3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103751563 (Tpm3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103751563 (Tpm3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103751563 (Tpm3)
   05414 Dilated cardiomyopathy
    103751563 (Tpm3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ngi04812]
    103751563 (Tpm3)
Cytoskeleton proteins [BR:ngi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     103751563 (Tpm3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ Crescentin TMF_DNA_bd ERM XhlA CENP-F_leu_zip ATG16 HrpB7 DUF1664 DHR10 ADIP DUF745 AAA_13 Laminin_I Fib_alpha
Other DBs
NCBI-GeneID: 103751563
NCBI-ProteinID: XP_008853275
LinkDB
Position
Un
AA seq 285 aa
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDK
YSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
ADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERT
EERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRA
EFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM
NT seq 858 nt   +upstreamnt  +downstreamnt
atgatggaggccatcaagaaaaagatgcagatgctaaagttggacaaggagaatgccctg
gaccgggctgagcaagctgaagctgagcagaagcaagcagaagaaagaagcaaacagctg
gaggatgagctagcagccatgcagaagaagctgaaggggacagaggatgagctggacaag
tattctgaagctttaaaggatgctcaggagaagctggagctagcagagaagaaggcagct
gatgctgaagccgaggtggcctccttgaaccgtaggatccagctggttgaagaggagctg
gaccgtgctcaggaacgcctggccactgccctgcagaagctggaggaagcagaaaaagct
gctgatgagagtgagagaggtatgaaggttattgaaaaccgggctctaaaagatgaagaa
aagatggaactccaggaaatccagctaaaagaagctaagcacattgcagaggaggcagac
aggaagtatgaagaggtggctcgtaagttggtgattattgaaggagacttggaacgcacc
gaggaacgggctgagctggcagagtctaagtgttctgagctggaggaggagctgaagaat
gtcaccaacaacctcaaatctcttgaggctcaggcggagaagtactctcaaaaagaagat
aaatacgaggaagaaataaagattcttactgataaactcaaggaggccgagacccgtgct
gagtttgctgagagatcggtagccaaactggaaaaaaccattgatgacttggaagataag
ctgaagtgcaccaaagaggaacacctctgtacacaaaggatgctggaccagactctgctg
gacctgaacgagatgtag

DBGET integrated database retrieval system