KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726779
Entry
103726779         CDS       T03372                                 

Gene name
Rb1
Definition
(RefSeq) RB transcriptional corepressor 1
  KO
K06618  retinoblastoma-associated protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04110  Cell cycle
ngi04218  Cellular senescence
ngi04934  Cushing syndrome
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05212  Pancreatic cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103726779 (Rb1)
   04218 Cellular senescence
    103726779 (Rb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103726779 (Rb1)
   05203 Viral carcinogenesis
    103726779 (Rb1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103726779 (Rb1)
   05225 Hepatocellular carcinoma
    103726779 (Rb1)
   05226 Gastric cancer
    103726779 (Rb1)
   05214 Glioma
    103726779 (Rb1)
   05220 Chronic myeloid leukemia
    103726779 (Rb1)
   05218 Melanoma
    103726779 (Rb1)
   05219 Bladder cancer
    103726779 (Rb1)
   05215 Prostate cancer
    103726779 (Rb1)
   05224 Breast cancer
    103726779 (Rb1)
   05222 Small cell lung cancer
    103726779 (Rb1)
   05223 Non-small cell lung cancer
    103726779 (Rb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103726779 (Rb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103726779 (Rb1)
   05161 Hepatitis B
    103726779 (Rb1)
   05160 Hepatitis C
    103726779 (Rb1)
   05163 Human cytomegalovirus infection
    103726779 (Rb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103726779 (Rb1)
   05169 Epstein-Barr virus infection
    103726779 (Rb1)
   05165 Human papillomavirus infection
    103726779 (Rb1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103726779 (Rb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103726779 (Rb1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103726779 (Rb1)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103726779 (Rb1)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    103726779 (Rb1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 TFIIB
Other DBs
NCBI-GeneID: 103726779
NCBI-ProteinID: XP_008822631
LinkDB
Position
Un
AA seq 885 aa
FGRLEFEETEEPEFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLEGHIQKKKELWGICI
FIAAVDLDEMPFTFTELQKNIETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYS
KLERTCELIYLRQPSSVISTEINCMLVLKISWITFLLAKGEVLQMEDDLVISFQLMLCVL
DYFIKFSPPALLREPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHEC
NIDEVKNVYFKNFIPFMNSLGIVSSNGLPEVESLSKRYEELYLKNKDLDARLFLDHDKTL
QTDPVDSFETERTPRKNNPDEEANMVPPHTPVRTVMNTIQQLMMILNSASDQPSENLISY
FNNCTVNPKENIMKRVKDVGHIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKS
EEERLSIQNFSKLLNDNVFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNILNL
KAFDFYKVIESFIKAEANLTREMIKHLERCEHRIMESFAWLSDSPLFDLIKQSKDGEGPA
DNLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTSRVNSAANAETQVASAFQTQKPLK
STSLSLFYKKVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQI
MMCSMYGICKVKNIDLKFKIIVTAYRDLPHAVQETFKRVLIREEEFDSIIVFYNSVFMQR
LKTNILQYASTRPPTLSPIPHIPRSPYKFSNSPLRIPGGNIYISPLKSPYKISEGLPTPT
KMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRNAEGSNPPKPLKKLRFDIEGSD
ETDGSKRLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDISNKEEK
NT seq 2658 nt   +upstreamnt  +downstreamnt
tttggcaggcttgagtttgaagaaaccgaagaacctgaatttactgcattatgtcagaaa
ttaaagataccagatcatgtcagagaaagagcttggttaacttgggaaaaagtttcatct
gtggatggagtattggaaggtcatattcaaaagaagaaggaactctggggcatctgcatc
tttattgcagcagttgaccttgatgagatgcctttcacttttactgagctacagaaaaac
atagaaaccagtgtctataaattctttgacttactaaaggaaattgataccagtaccaaa
gttgataatgctatgtccagactgttgaagaagtacaatgtgttatgtgcactctacagc
aagctagaacggacatgtgaacttatatatttaagacaacccagcagtgtgatatctact
gaaataaattgtatgttggtgctaaaaatttcttggatcacttttttactagcaaaagga
gaagtattacaaatggaagatgatctggtgatttcatttcagttaatgttgtgtgtactt
gactattttatcaagttctcacctcctgcactgctcagagaaccatacaaaacagctgta
attcccattaatggttcacctcgaacacccaggcgaggtcagaacagaagtgcccggata
gcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaacatgaatgt
aatatagatgaggtgaaaaatgtttatttcaaaaattttataccttttatgaattctctt
ggaattgtatcttctaatggacttccagaggttgaaagtctctctaaacgatatgaagaa
ctttatcttaaaaataaagacctagatgcaagactttttttggatcatgataaaactctt
cagactgaccctgtagacagttttgaaacagagagaacaccacgaaaaaataaccctgat
gaagaggcaaatatggttcctccacacacgccagttaggactgttatgaatactatccaa
cagctaatgatgattttaaattccgcgagtgatcaaccatcagaaaatttgatttcctac
ttcaataactgcacagtgaatccaaaagaaaatatcatgaaaagagtgaaggatgttgga
cacatctttaaagagaagtttgcgaaagctgtgggacagggatgtgtcgaaattggatca
cagcgatataaacttggagtacgattatactaccgagtgatggaatccatgcttaaatca
gaagaagaacgattatccattcaaaattttagcaaactcctgaatgacaacgtctttcat
atgtctttattggcatgtgctcttgaagttgtaatggccacatatagcagaagtacatct
cagaatcttgattctggaacagatttgtccttcccatggattctgaatatacttaattta
aaagcctttgatttttacaaagtgatcgaaagttttatcaaagcagaagccaacttgaca
agagaaatgataaaacacttagaacgatgtgaacatcgaatcatggaatcctttgcatgg
ctttcagattcacctttatttgatctcattaaacaatcaaaggatggagagggaccagct
gataaccttgagtctgcttgtcctctcaaccttcctctccagaataatcatactgcagca
gatatgtatctttctcctgtaagatccccaaagaaaaaaggttcaacttcacgtgtaaat
tctgctgcaaatgcagagacacaagtagcctcagccttccagacacagaagccattgaaa
tctacctccctttccctgttttacaaaaaagtgtaccggctagcatatctccgactaaat
acactgtgtgcgcgtcttctgtctgaccacccagaactagagcacattatttggactctg
ttccagcatacattgcaaaatgaatatgaactcatgagagaccggcatttggaccagatt
atgatgtgctctatgtatggtatatgtaaagtgaagaacattgacctgaagttcaaaatc
atcgtaacagcctacagagatctgcctcacgctgtccaggagaccttcaaacgtgttttg
atcagagaagaggagtttgattccattatagtattctataactcggttttcatgcagaga
ctaaagacaaacattttacaatatgcttccaccaggcctcctaccttgtcaccaatacct
cacattcctcgaagcccctacaagttttctaattcacccttaagaattcctggaggtaac
atctatatatcacccttgaagagtccttataaaatttcagaaggtctgccaacacccaca
aagatgactccaagatcaagaatcttagtctcaattggtgaatcatttgggacatctgag
aagttccagaaaataaatcagatggtatgtaatagtgaccgagtgctcaaaaggaatgct
gaaggcagcaaccctcctaaaccactgaaaaaactgcgctttgacatcgagggatcagat
gaaacagatggaagtaaacgtctcccaggggagtccaaattccaacagaaactggcagag
atgacttctactcgaacacgaatgcaaaagcaaaaaatgaatgacagcatggatatctcc
aacaaggaggaaaagtga

DBGET integrated database retrieval system