KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726879
Entry
103726879         CDS       T03372                                 

Gene name
Pik3r2
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04210  Apoptosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04218  Cellular senescence
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04620  Toll-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04668  TNF signaling pathway
ngi04670  Leukocyte transendothelial migration
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04810  Regulation of actin cytoskeleton
ngi04910  Insulin signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04926  Relaxin signaling pathway
ngi04929  GnRH secretion
ngi04930  Type II diabetes mellitus
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi04960  Aldosterone-regulated sodium reabsorption
ngi04973  Carbohydrate digestion and absorption
ngi05010  Alzheimer disease
ngi05017  Spinocerebellar ataxia
ngi05020  Prion disease
ngi05100  Bacterial invasion of epithelial cells
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05146  Amoebiasis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05207  Chemical carcinogenesis - receptor activation
ngi05208  Chemical carcinogenesis - reactive oxygen species
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05415  Diabetic cardiomyopathy
ngi05417  Lipid and atherosclerosis
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103726879 (Pik3r2)
   04014 Ras signaling pathway
    103726879 (Pik3r2)
   04015 Rap1 signaling pathway
    103726879 (Pik3r2)
   04370 VEGF signaling pathway
    103726879 (Pik3r2)
   04630 JAK-STAT signaling pathway
    103726879 (Pik3r2)
   04668 TNF signaling pathway
    103726879 (Pik3r2)
   04066 HIF-1 signaling pathway
    103726879 (Pik3r2)
   04068 FoxO signaling pathway
    103726879 (Pik3r2)
   04070 Phosphatidylinositol signaling system
    103726879 (Pik3r2)
   04072 Phospholipase D signaling pathway
    103726879 (Pik3r2)
   04071 Sphingolipid signaling pathway
    103726879 (Pik3r2)
   04024 cAMP signaling pathway
    103726879 (Pik3r2)
   04151 PI3K-Akt signaling pathway
    103726879 (Pik3r2)
   04152 AMPK signaling pathway
    103726879 (Pik3r2)
   04150 mTOR signaling pathway
    103726879 (Pik3r2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103726879 (Pik3r2)
  09143 Cell growth and death
   04210 Apoptosis
    103726879 (Pik3r2)
   04218 Cellular senescence
    103726879 (Pik3r2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103726879 (Pik3r2)
   04550 Signaling pathways regulating pluripotency of stem cells
    103726879 (Pik3r2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103726879 (Pik3r2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103726879 (Pik3r2)
   04613 Neutrophil extracellular trap formation
    103726879 (Pik3r2)
   04620 Toll-like receptor signaling pathway
    103726879 (Pik3r2)
   04625 C-type lectin receptor signaling pathway
    103726879 (Pik3r2)
   04650 Natural killer cell mediated cytotoxicity
    103726879 (Pik3r2)
   04660 T cell receptor signaling pathway
    103726879 (Pik3r2)
   04662 B cell receptor signaling pathway
    103726879 (Pik3r2)
   04664 Fc epsilon RI signaling pathway
    103726879 (Pik3r2)
   04666 Fc gamma R-mediated phagocytosis
    103726879 (Pik3r2)
   04670 Leukocyte transendothelial migration
    103726879 (Pik3r2)
   04062 Chemokine signaling pathway
    103726879 (Pik3r2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103726879 (Pik3r2)
   04923 Regulation of lipolysis in adipocytes
    103726879 (Pik3r2)
   04929 GnRH secretion
    103726879 (Pik3r2)
   04915 Estrogen signaling pathway
    103726879 (Pik3r2)
   04914 Progesterone-mediated oocyte maturation
    103726879 (Pik3r2)
   04917 Prolactin signaling pathway
    103726879 (Pik3r2)
   04926 Relaxin signaling pathway
    103726879 (Pik3r2)
   04935 Growth hormone synthesis, secretion and action
    103726879 (Pik3r2)
   04919 Thyroid hormone signaling pathway
    103726879 (Pik3r2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103726879 (Pik3r2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103726879 (Pik3r2)
  09156 Nervous system
   04725 Cholinergic synapse
    103726879 (Pik3r2)
   04722 Neurotrophin signaling pathway
    103726879 (Pik3r2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103726879 (Pik3r2)
  09158 Development and regeneration
   04360 Axon guidance
    103726879 (Pik3r2)
   04380 Osteoclast differentiation
    103726879 (Pik3r2)
  09149 Aging
   04211 Longevity regulating pathway
    103726879 (Pik3r2)
   04213 Longevity regulating pathway - multiple species
    103726879 (Pik3r2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103726879 (Pik3r2)
   05206 MicroRNAs in cancer
    103726879 (Pik3r2)
   05205 Proteoglycans in cancer
    103726879 (Pik3r2)
   05207 Chemical carcinogenesis - receptor activation
    103726879 (Pik3r2)
   05208 Chemical carcinogenesis - reactive oxygen species
    103726879 (Pik3r2)
   05203 Viral carcinogenesis
    103726879 (Pik3r2)
   05230 Central carbon metabolism in cancer
    103726879 (Pik3r2)
   05231 Choline metabolism in cancer
    103726879 (Pik3r2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103726879 (Pik3r2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103726879 (Pik3r2)
   05212 Pancreatic cancer
    103726879 (Pik3r2)
   05225 Hepatocellular carcinoma
    103726879 (Pik3r2)
   05226 Gastric cancer
    103726879 (Pik3r2)
   05214 Glioma
    103726879 (Pik3r2)
   05221 Acute myeloid leukemia
    103726879 (Pik3r2)
   05220 Chronic myeloid leukemia
    103726879 (Pik3r2)
   05218 Melanoma
    103726879 (Pik3r2)
   05211 Renal cell carcinoma
    103726879 (Pik3r2)
   05215 Prostate cancer
    103726879 (Pik3r2)
   05213 Endometrial cancer
    103726879 (Pik3r2)
   05224 Breast cancer
    103726879 (Pik3r2)
   05222 Small cell lung cancer
    103726879 (Pik3r2)
   05223 Non-small cell lung cancer
    103726879 (Pik3r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103726879 (Pik3r2)
   05170 Human immunodeficiency virus 1 infection
    103726879 (Pik3r2)
   05161 Hepatitis B
    103726879 (Pik3r2)
   05160 Hepatitis C
    103726879 (Pik3r2)
   05171 Coronavirus disease - COVID-19
    103726879 (Pik3r2)
   05164 Influenza A
    103726879 (Pik3r2)
   05162 Measles
    103726879 (Pik3r2)
   05168 Herpes simplex virus 1 infection
    103726879 (Pik3r2)
   05163 Human cytomegalovirus infection
    103726879 (Pik3r2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103726879 (Pik3r2)
   05169 Epstein-Barr virus infection
    103726879 (Pik3r2)
   05165 Human papillomavirus infection
    103726879 (Pik3r2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103726879 (Pik3r2)
   05100 Bacterial invasion of epithelial cells
    103726879 (Pik3r2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103726879 (Pik3r2)
   05142 Chagas disease
    103726879 (Pik3r2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103726879 (Pik3r2)
   05017 Spinocerebellar ataxia
    103726879 (Pik3r2)
   05020 Prion disease
    103726879 (Pik3r2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103726879 (Pik3r2)
   05418 Fluid shear stress and atherosclerosis
    103726879 (Pik3r2)
   05415 Diabetic cardiomyopathy
    103726879 (Pik3r2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103726879 (Pik3r2)
   04932 Non-alcoholic fatty liver disease
    103726879 (Pik3r2)
   04931 Insulin resistance
    103726879 (Pik3r2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103726879 (Pik3r2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103726879 (Pik3r2)
   01524 Platinum drug resistance
    103726879 (Pik3r2)
   01522 Endocrine resistance
    103726879 (Pik3r2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103726879 (Pik3r2)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103726879 (Pik3r2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 Ribosomal_L22e ATG11 Mod_r
Other DBs
NCBI-GeneID: 103726879
NCBI-ProteinID: XP_008822787
LinkDB
Position
Un
AA seq 722 aa
MAMAGAEGFQYRALYPFRRERPDDLELLPGDLLVVSRAALQALGVADGGERCPHNVGWMP
GFNERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPLDGSSESGLILPDLREQF
SPPDPAPPILVKLAEAIEQTGLDSECYYRPELPVPRTDWSLSDVEHWEPVALADAVKGFL
LALPTALVTPEAVAEAHRALREAAGPVGLVLEPPTLPLHPALTLRFLLQHLGRLVRRAPA
PGPAVHALALAFGPLLLRALPPGAAEGSEPNPDFPELLVEKLLQEHVDEQEAAPPALPPK
PSKAKPTPTGLANGGSPLSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIHGEY
TLTLRKGGNNKLIKVFHRDGHYGFSEPLTFGSVVELISHYRHESLAQYNAKLDTRLLYPV
SKYQQDQVVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFN
ETIKIFEEQGQTQEKCSRQYLDRFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQD
LRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQY
SLMEEEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDT
KHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPA
AR
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggccatggccggagcagagggcttccagtaccgggctctgtacccattccgccgggag
cggcctgacgacctggagctactgccgggagacttgctggtggtgagccgtgcagcccta
caggcgctgggcgtggcagatggtggggagcgttgcccgcacaacgtgggctggatgccc
ggcttcaatgagcgcacccggcagcggggggacttccccgggacatatgtggagttcctg
gggcctgtggctctggctcgaccaggcccaaggccccgaggcccccgtccactgcctgct
agacccctggatgggtcctccgagtcaggcctcatactcccagaccttcgggaacagttc
tctcctcctgacccagcaccccccatcctggtgaagctggcagaggccattgagcaaaca
gggctggacagtgagtgctactacaggccagaactgcctgtgcccaggacagactggtcc
ctgagtgatgtggagcactgggagcctgtggccttggcagacgctgtgaagggcttcctg
ctggccttacctacggccctggtgacccctgaggctgtggcggaggcacatcgggcactg
cgggaagctgctgggcccgtgggactggtgctggaacccccaacgctgccgctgcacccg
gcactgacgctgcggttcctgctgcagcacctgggccgcctggtgcggagagcgcccgcc
cctgggcctgctgttcatgcactggctctagccttcgggcctctgctactgcgcgccctg
ccaccaggggccgctgaggggagtgagccgaaccctgacttccctgaactgctggtggag
aaactgctacaagagcacgtggatgaacaggaggccgcgcccccagcactgccacctaag
ccctctaaggcaaagccaacgcccacaggcctggccaatggagggagcccgctgtctcta
caggatgcggagtggtactggggggacatctccagggaagaagtcaatgagaagctccgg
gacacacccgatggcaccttcctggtccgagacgcatccagtaagatccatggagagtac
acactcacactcaggaaaggtggtaacaataaattgattaaggtcttccaccgtgatgga
cactacggcttctcggagcccctcaccttcggctcggtggtagagctgatctcccactat
cgccatgagtcactggcacagtataacgccaagctggacactcgcctcctctaccccgtg
tccaagtaccagcaggaccaggtggtgaaagaggacagcgtggaggcagtgggggcccag
ctcaaagtgtaccaccagcagtaccaggacaagagccgagagtacgaccagctgtacgag
gagtacacgcgtacctcccaggaactgcagatgaagcgcacagccatcgaagccttcaat
gaaaccatcaagatctttgaagaacaaggccagacacaggagaagtgcagcaggcagtat
ctggaccgcttccgacgggagggcaatgagaaggagatgcagaggatccttctgaactct
gaacggctcaagtcgcgaattgcggagatacatgagagtcgcacaaaactggagcaagac
ctgcgggcacaggcctcagacaaccgtgagatcgacaagcgcatgaacagcctcaagcct
gatctcatgcaactgcgcaagatcagagaccagtaccttgtgtggctcacccagaagggc
gcccggcagaagaaaatcaatgagtggctgggaatcaaaaatgagacagaggaccagtat
tccctgatggaggaggaggatgacctccctcaccacgaggaacgcacatggtacgtgggc
aagatcaaccgcacccaggcggaagagatgctgagcgggaagcgtgacgggacgttcctc
atccgtgagagcagccagcggggctgctatgcctgctccgtggtggtggacggtgacacc
aagcattgtgtcatctaccgcacagccaccggttttggctttgcagagccttacaacctg
tatggatcgctgaaggagctggtgctgcactaccagcacgcatccctcgtgcaacacaac
gatgctctcacggtcacccttgcccaccctgtacgtgccccagggccagggcccccagct
gcccgctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730305
Entry
103730305         CDS       T03372                                 

Gene name
Pik3r3
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04210  Apoptosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04218  Cellular senescence
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04620  Toll-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04668  TNF signaling pathway
ngi04670  Leukocyte transendothelial migration
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04810  Regulation of actin cytoskeleton
ngi04910  Insulin signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04926  Relaxin signaling pathway
ngi04929  GnRH secretion
ngi04930  Type II diabetes mellitus
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi04960  Aldosterone-regulated sodium reabsorption
ngi04973  Carbohydrate digestion and absorption
ngi05010  Alzheimer disease
ngi05017  Spinocerebellar ataxia
ngi05020  Prion disease
ngi05100  Bacterial invasion of epithelial cells
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05146  Amoebiasis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05207  Chemical carcinogenesis - receptor activation
ngi05208  Chemical carcinogenesis - reactive oxygen species
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05415  Diabetic cardiomyopathy
ngi05417  Lipid and atherosclerosis
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103730305 (Pik3r3)
   04014 Ras signaling pathway
    103730305 (Pik3r3)
   04015 Rap1 signaling pathway
    103730305 (Pik3r3)
   04370 VEGF signaling pathway
    103730305 (Pik3r3)
   04630 JAK-STAT signaling pathway
    103730305 (Pik3r3)
   04668 TNF signaling pathway
    103730305 (Pik3r3)
   04066 HIF-1 signaling pathway
    103730305 (Pik3r3)
   04068 FoxO signaling pathway
    103730305 (Pik3r3)
   04070 Phosphatidylinositol signaling system
    103730305 (Pik3r3)
   04072 Phospholipase D signaling pathway
    103730305 (Pik3r3)
   04071 Sphingolipid signaling pathway
    103730305 (Pik3r3)
   04024 cAMP signaling pathway
    103730305 (Pik3r3)
   04151 PI3K-Akt signaling pathway
    103730305 (Pik3r3)
   04152 AMPK signaling pathway
    103730305 (Pik3r3)
   04150 mTOR signaling pathway
    103730305 (Pik3r3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103730305 (Pik3r3)
  09143 Cell growth and death
   04210 Apoptosis
    103730305 (Pik3r3)
   04218 Cellular senescence
    103730305 (Pik3r3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103730305 (Pik3r3)
   04550 Signaling pathways regulating pluripotency of stem cells
    103730305 (Pik3r3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103730305 (Pik3r3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103730305 (Pik3r3)
   04613 Neutrophil extracellular trap formation
    103730305 (Pik3r3)
   04620 Toll-like receptor signaling pathway
    103730305 (Pik3r3)
   04625 C-type lectin receptor signaling pathway
    103730305 (Pik3r3)
   04650 Natural killer cell mediated cytotoxicity
    103730305 (Pik3r3)
   04660 T cell receptor signaling pathway
    103730305 (Pik3r3)
   04662 B cell receptor signaling pathway
    103730305 (Pik3r3)
   04664 Fc epsilon RI signaling pathway
    103730305 (Pik3r3)
   04666 Fc gamma R-mediated phagocytosis
    103730305 (Pik3r3)
   04670 Leukocyte transendothelial migration
    103730305 (Pik3r3)
   04062 Chemokine signaling pathway
    103730305 (Pik3r3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103730305 (Pik3r3)
   04923 Regulation of lipolysis in adipocytes
    103730305 (Pik3r3)
   04929 GnRH secretion
    103730305 (Pik3r3)
   04915 Estrogen signaling pathway
    103730305 (Pik3r3)
   04914 Progesterone-mediated oocyte maturation
    103730305 (Pik3r3)
   04917 Prolactin signaling pathway
    103730305 (Pik3r3)
   04926 Relaxin signaling pathway
    103730305 (Pik3r3)
   04935 Growth hormone synthesis, secretion and action
    103730305 (Pik3r3)
   04919 Thyroid hormone signaling pathway
    103730305 (Pik3r3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103730305 (Pik3r3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103730305 (Pik3r3)
  09156 Nervous system
   04725 Cholinergic synapse
    103730305 (Pik3r3)
   04722 Neurotrophin signaling pathway
    103730305 (Pik3r3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103730305 (Pik3r3)
  09158 Development and regeneration
   04360 Axon guidance
    103730305 (Pik3r3)
   04380 Osteoclast differentiation
    103730305 (Pik3r3)
  09149 Aging
   04211 Longevity regulating pathway
    103730305 (Pik3r3)
   04213 Longevity regulating pathway - multiple species
    103730305 (Pik3r3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103730305 (Pik3r3)
   05206 MicroRNAs in cancer
    103730305 (Pik3r3)
   05205 Proteoglycans in cancer
    103730305 (Pik3r3)
   05207 Chemical carcinogenesis - receptor activation
    103730305 (Pik3r3)
   05208 Chemical carcinogenesis - reactive oxygen species
    103730305 (Pik3r3)
   05203 Viral carcinogenesis
    103730305 (Pik3r3)
   05230 Central carbon metabolism in cancer
    103730305 (Pik3r3)
   05231 Choline metabolism in cancer
    103730305 (Pik3r3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103730305 (Pik3r3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103730305 (Pik3r3)
   05212 Pancreatic cancer
    103730305 (Pik3r3)
   05225 Hepatocellular carcinoma
    103730305 (Pik3r3)
   05226 Gastric cancer
    103730305 (Pik3r3)
   05214 Glioma
    103730305 (Pik3r3)
   05221 Acute myeloid leukemia
    103730305 (Pik3r3)
   05220 Chronic myeloid leukemia
    103730305 (Pik3r3)
   05218 Melanoma
    103730305 (Pik3r3)
   05211 Renal cell carcinoma
    103730305 (Pik3r3)
   05215 Prostate cancer
    103730305 (Pik3r3)
   05213 Endometrial cancer
    103730305 (Pik3r3)
   05224 Breast cancer
    103730305 (Pik3r3)
   05222 Small cell lung cancer
    103730305 (Pik3r3)
   05223 Non-small cell lung cancer
    103730305 (Pik3r3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103730305 (Pik3r3)
   05170 Human immunodeficiency virus 1 infection
    103730305 (Pik3r3)
   05161 Hepatitis B
    103730305 (Pik3r3)
   05160 Hepatitis C
    103730305 (Pik3r3)
   05171 Coronavirus disease - COVID-19
    103730305 (Pik3r3)
   05164 Influenza A
    103730305 (Pik3r3)
   05162 Measles
    103730305 (Pik3r3)
   05168 Herpes simplex virus 1 infection
    103730305 (Pik3r3)
   05163 Human cytomegalovirus infection
    103730305 (Pik3r3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103730305 (Pik3r3)
   05169 Epstein-Barr virus infection
    103730305 (Pik3r3)
   05165 Human papillomavirus infection
    103730305 (Pik3r3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103730305 (Pik3r3)
   05100 Bacterial invasion of epithelial cells
    103730305 (Pik3r3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103730305 (Pik3r3)
   05142 Chagas disease
    103730305 (Pik3r3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103730305 (Pik3r3)
   05017 Spinocerebellar ataxia
    103730305 (Pik3r3)
   05020 Prion disease
    103730305 (Pik3r3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103730305 (Pik3r3)
   05418 Fluid shear stress and atherosclerosis
    103730305 (Pik3r3)
   05415 Diabetic cardiomyopathy
    103730305 (Pik3r3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103730305 (Pik3r3)
   04932 Non-alcoholic fatty liver disease
    103730305 (Pik3r3)
   04931 Insulin resistance
    103730305 (Pik3r3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103730305 (Pik3r3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103730305 (Pik3r3)
   01524 Platinum drug resistance
    103730305 (Pik3r3)
   01522 Endocrine resistance
    103730305 (Pik3r3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103730305 (Pik3r3)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103730305 (Pik3r3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 PI_PP_I Laminin_I
Other DBs
NCBI-GeneID: 103730305
NCBI-ProteinID: XP_008826716
LinkDB
Position
Un
AA seq 478 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPDIQREFVGRGVRRVENEALPPKPPK
PMTSAVTNGMKEGSVTLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLT
LRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRY
QQDQLVKEDNIDAVGKKLQEYHSQYQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETI
KIFEEQCHTQEQYSKEYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKK
QALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIRNEDADETYFI
NEEDENLPHYDEKTWFVEDVNRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKH
CVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAEMPSFCR
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctactcgacggaactgatattttatattgaaatggatcctccagacatacaaagggaa
tttgttgggcggggagtgaggagggtagaaaatgaagctctccctccaaagccacctaag
ccaatgacttcagcagttacaaatggaatgaaagagggttccgttacccttcaagatgca
gaatggtactggggtgatatttccagggaagaggtaaatgacaaattacgggacatgccg
gatggtaccttcttagtcagagatgcctcaacaaaaatgcagggagattatactttgact
ttaaggaagggaggcaataataagttaataaagatctatcatcgggatggtaaatatggc
ttctctgatcctctgacatttaattctgtggtggagctcattaaccactatcatcatgaa
tctcttgctcagtacaatcccaaacttgatgtgaagctgatgtatccagtgtccagatac
caacaggatcagttggtgaaagaagataacattgatgcagtaggcaaaaaactgcaggag
tatcactctcagtatcaggagaagagccgagagtatgacaggctgtatgaggagtacacc
aggacatcccaggaaatacaaatgaagagaactgcaattgaagcttttaatgaaacaatt
aaaatatttgaggagcagtgtcacacacaagaacaatacagcaaagaatatattgagagg
tttcgcagagaggggaatgaaaaggagattgaacgaattatgatgaattatgataaattg
aaatcacgtcttggtgaaattcatgatagtaaaatgcgtctagaacaggatttgaagaaa
caggctttggacaaccgagaaatagataaaaaaatgaatagcatcaaacctgacttgatc
cagctgcgtaagatccgagatcagcatcttgtatggctcaatcacaaaggagtgagacag
aagcgcctgaatgcctggctggggatcaggaatgaggatgctgatgaaacttactttatc
aatgaggaagatgagaacctgcctcattatgatgagaaaacctggtttgttgaggatgtc
aatcgagtacaagcagaggacttgctttatggaaaaccagatggtgcattcttaattcgt
gagagcagcaagaaagggtgttacgcttgctctgtcgttgcggatggggaagtgaaacac
tgtgtgatctacagcactgctagaggatacggctttgcagaaccctacaacctgtatagc
tcactgaaggagctggtgctccattaccagcagacatccctggttcaacacaatgactcc
ctcaatgtcaggcttgcctaccctgtccacgcagagatgccttcgttctgcagataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103733121
Entry
103733121         CDS       T03372                                 

Gene name
Pik3cd
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00562  Inositol phosphate metabolism
ngi01100  Metabolic pathways
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04210  Apoptosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04218  Cellular senescence
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04620  Toll-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04668  TNF signaling pathway
ngi04670  Leukocyte transendothelial migration
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04810  Regulation of actin cytoskeleton
ngi04910  Insulin signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04926  Relaxin signaling pathway
ngi04929  GnRH secretion
ngi04930  Type II diabetes mellitus
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi04960  Aldosterone-regulated sodium reabsorption
ngi04973  Carbohydrate digestion and absorption
ngi05010  Alzheimer disease
ngi05017  Spinocerebellar ataxia
ngi05020  Prion disease
ngi05100  Bacterial invasion of epithelial cells
ngi05132  Salmonella infection
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05146  Amoebiasis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05207  Chemical carcinogenesis - receptor activation
ngi05208  Chemical carcinogenesis - reactive oxygen species
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05415  Diabetic cardiomyopathy
ngi05417  Lipid and atherosclerosis
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103733121 (Pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103733121 (Pik3cd)
   04014 Ras signaling pathway
    103733121 (Pik3cd)
   04015 Rap1 signaling pathway
    103733121 (Pik3cd)
   04370 VEGF signaling pathway
    103733121 (Pik3cd)
   04630 JAK-STAT signaling pathway
    103733121 (Pik3cd)
   04668 TNF signaling pathway
    103733121 (Pik3cd)
   04066 HIF-1 signaling pathway
    103733121 (Pik3cd)
   04068 FoxO signaling pathway
    103733121 (Pik3cd)
   04070 Phosphatidylinositol signaling system
    103733121 (Pik3cd)
   04072 Phospholipase D signaling pathway
    103733121 (Pik3cd)
   04071 Sphingolipid signaling pathway
    103733121 (Pik3cd)
   04024 cAMP signaling pathway
    103733121 (Pik3cd)
   04151 PI3K-Akt signaling pathway
    103733121 (Pik3cd)
   04152 AMPK signaling pathway
    103733121 (Pik3cd)
   04150 mTOR signaling pathway
    103733121 (Pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103733121 (Pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    103733121 (Pik3cd)
   04218 Cellular senescence
    103733121 (Pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103733121 (Pik3cd)
   04550 Signaling pathways regulating pluripotency of stem cells
    103733121 (Pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103733121 (Pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103733121 (Pik3cd)
   04613 Neutrophil extracellular trap formation
    103733121 (Pik3cd)
   04620 Toll-like receptor signaling pathway
    103733121 (Pik3cd)
   04625 C-type lectin receptor signaling pathway
    103733121 (Pik3cd)
   04650 Natural killer cell mediated cytotoxicity
    103733121 (Pik3cd)
   04660 T cell receptor signaling pathway
    103733121 (Pik3cd)
   04662 B cell receptor signaling pathway
    103733121 (Pik3cd)
   04664 Fc epsilon RI signaling pathway
    103733121 (Pik3cd)
   04666 Fc gamma R-mediated phagocytosis
    103733121 (Pik3cd)
   04670 Leukocyte transendothelial migration
    103733121 (Pik3cd)
   04062 Chemokine signaling pathway
    103733121 (Pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103733121 (Pik3cd)
   04923 Regulation of lipolysis in adipocytes
    103733121 (Pik3cd)
   04929 GnRH secretion
    103733121 (Pik3cd)
   04915 Estrogen signaling pathway
    103733121 (Pik3cd)
   04914 Progesterone-mediated oocyte maturation
    103733121 (Pik3cd)
   04917 Prolactin signaling pathway
    103733121 (Pik3cd)
   04926 Relaxin signaling pathway
    103733121 (Pik3cd)
   04935 Growth hormone synthesis, secretion and action
    103733121 (Pik3cd)
   04919 Thyroid hormone signaling pathway
    103733121 (Pik3cd)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103733121 (Pik3cd)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103733121 (Pik3cd)
  09156 Nervous system
   04725 Cholinergic synapse
    103733121 (Pik3cd)
   04722 Neurotrophin signaling pathway
    103733121 (Pik3cd)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103733121 (Pik3cd)
  09158 Development and regeneration
   04360 Axon guidance
    103733121 (Pik3cd)
   04380 Osteoclast differentiation
    103733121 (Pik3cd)
  09149 Aging
   04211 Longevity regulating pathway
    103733121 (Pik3cd)
   04213 Longevity regulating pathway - multiple species
    103733121 (Pik3cd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103733121 (Pik3cd)
   05206 MicroRNAs in cancer
    103733121 (Pik3cd)
   05205 Proteoglycans in cancer
    103733121 (Pik3cd)
   05207 Chemical carcinogenesis - receptor activation
    103733121 (Pik3cd)
   05208 Chemical carcinogenesis - reactive oxygen species
    103733121 (Pik3cd)
   05203 Viral carcinogenesis
    103733121 (Pik3cd)
   05230 Central carbon metabolism in cancer
    103733121 (Pik3cd)
   05231 Choline metabolism in cancer
    103733121 (Pik3cd)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103733121 (Pik3cd)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103733121 (Pik3cd)
   05212 Pancreatic cancer
    103733121 (Pik3cd)
   05225 Hepatocellular carcinoma
    103733121 (Pik3cd)
   05226 Gastric cancer
    103733121 (Pik3cd)
   05214 Glioma
    103733121 (Pik3cd)
   05221 Acute myeloid leukemia
    103733121 (Pik3cd)
   05220 Chronic myeloid leukemia
    103733121 (Pik3cd)
   05218 Melanoma
    103733121 (Pik3cd)
   05211 Renal cell carcinoma
    103733121 (Pik3cd)
   05215 Prostate cancer
    103733121 (Pik3cd)
   05213 Endometrial cancer
    103733121 (Pik3cd)
   05224 Breast cancer
    103733121 (Pik3cd)
   05222 Small cell lung cancer
    103733121 (Pik3cd)
   05223 Non-small cell lung cancer
    103733121 (Pik3cd)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103733121 (Pik3cd)
   05170 Human immunodeficiency virus 1 infection
    103733121 (Pik3cd)
   05161 Hepatitis B
    103733121 (Pik3cd)
   05160 Hepatitis C
    103733121 (Pik3cd)
   05171 Coronavirus disease - COVID-19
    103733121 (Pik3cd)
   05164 Influenza A
    103733121 (Pik3cd)
   05162 Measles
    103733121 (Pik3cd)
   05168 Herpes simplex virus 1 infection
    103733121 (Pik3cd)
   05163 Human cytomegalovirus infection
    103733121 (Pik3cd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103733121 (Pik3cd)
   05169 Epstein-Barr virus infection
    103733121 (Pik3cd)
   05165 Human papillomavirus infection
    103733121 (Pik3cd)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103733121 (Pik3cd)
   05135 Yersinia infection
    103733121 (Pik3cd)
   05100 Bacterial invasion of epithelial cells
    103733121 (Pik3cd)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103733121 (Pik3cd)
   05142 Chagas disease
    103733121 (Pik3cd)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103733121 (Pik3cd)
   05017 Spinocerebellar ataxia
    103733121 (Pik3cd)
   05020 Prion disease
    103733121 (Pik3cd)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103733121 (Pik3cd)
   05418 Fluid shear stress and atherosclerosis
    103733121 (Pik3cd)
   05415 Diabetic cardiomyopathy
    103733121 (Pik3cd)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103733121 (Pik3cd)
   04932 Non-alcoholic fatty liver disease
    103733121 (Pik3cd)
   04931 Insulin resistance
    103733121 (Pik3cd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103733121 (Pik3cd)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103733121 (Pik3cd)
   01524 Platinum drug resistance
    103733121 (Pik3cd)
   01522 Endocrine resistance
    103733121 (Pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103733121 (Pik3cd)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103733121 (Pik3cd)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103733121 (Pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 103733121
NCBI-ProteinID: XP_008830114
LinkDB
Position
Un
AA seq 1045 aa
MPPGVDCPMEFWTKEESQSVAVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPFFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAALRQQLGWEAWLQYSFPLQLEPSARSWGP
GTLRVPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQPLVERPEDYA
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
TKPPPIPAKKPSSVSLWSLEQPFCIELIEGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVSVCSEPVWKQRLEFDISICDLPRMARLCFALYAVVEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERRLYMWPSVPDEKGELLNPAGTVRSNPNTESAAALVICLPEVAP
HPVYFPALEKILELGRHGERGRITEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLGALELLDFNFPDCHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPHTKEMMHMCMR
QETYMEALSHLQSPLDPSTLLEEVCSVEQCTFMDSKMKPLWIMYSSEEAGSAGSVGIIFK
NGDDLRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQL
NKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNI
MIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTSNSEKFERFRGY
CERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKF
NEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3138 nt   +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggagttctggaccaaagaggagagccagagcgtg
gccgtcgacttcttgctgcccacaggggtctacctgaacttcccagtgtcccgcaatgcc
aacctcagcaccatcaagcaggtgttgtggcatcgcgcacagtatgagccgttcttccac
atgctcagcgacccggaggcctatgtgttcacctgtgtcaaccagacagctgagcagcag
gagctggaggatgagcagcggcgactgtgtgatgtccagcccttcctgcctgtgctgcgc
cttgtggcccgagagggtgaccgtgtgaagaagctcatcaactcacagatcagcctcctc
atcggcaaaggcctccatgagtttgactccctgcgagacccagaagtgaatgacttccga
accaagatgcgccagttttgtgaggaggccgctgctctccgccagcagctaggctgggag
gcctggctacagtatagcttccccctgcagctggagccctcagcaaggagctgggggcct
ggaacgctgcgtgtccccaaccgagccctgctggtcaatgtgaagttcgagggcagtgag
gagagcttcactttccaggtgtctactaaggacatgcccctggcactgatggcctgtgcc
ctccggaagaaggccacagtgttccggcagcccctggtggagcggcccgaggactatgcg
ctgcaggtgaatgggaggcatgagtacctctatggcagctacccgctctgccagttccag
tatatctgcagttgcttgcacagcggactgaccccccatctgaccatggtccactcctcc
tccatccttgctatgagggatgaacagagcaaccctgccccccaagtccagaaaccacgc
accaaacctcctcccattcctgccaagaagccttcctctgtgtccctgtggtccctggag
cagccattctgcatagagctgatcgagggcagcaaagtgaacgccgatgagcggatgaag
ctggtggtacaggctgggctcttccatggcaacgagatgctgtgcaagacggtgtctagc
tcggaggtgagtgtgtgttcagagcccgtgtggaagcagcggctggagtttgacatcagc
atctgtgacctaccgcgcatggcccggctctgcttcgccctatacgctgtggtcgagaaa
gccaagaaggctcgctccaccaagaagaaatccaagaaagcggactgccccatcgcctgg
gccaacctcatgctattcgactacaaagaccagctcaagactggggagcgccgtctctac
atgtggccctctgtcccagatgagaaaggagagctgctgaaccctgcgggtacagtgcgc
agtaaccccaacacagagagtgctgctgccttggtcatctgcctgcccgaggtggccccc
catcctgtgtacttccctgccctggagaagatcctggagctggggcgtcatggagaacgt
gggcgcatcacagaggaggagcagctgcagctgcgggaaatcctggagcggcgggggtct
ggggagctgtatgaacatgagaaagacctggtgtggaagatgcggcatgaagtccaggag
cacttcccggaggcactggcccgcctgctgctggtcaccaagtggaacaagcacgaggat
gtggcccagatgctgtatttgctgtgctcctggcccgagctgcctgtgctgggtgccctg
gagctgctggacttcaacttcccggactgccacgtgggctccttcgccatcaagtcccta
cggaaactgacggacgacgagcttttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctggactgtgagctgaccaaattcttgctggaccgtgccttggccaac
cgcaagatcggccacttcctcttctggcaccttcgctccgagatgcacgtaccatcagtg
gccctgcgttttggcctcatcatggaggcctactgcagaggtagcactcaccacatgaag
gtgctgatgaaacagggggaagcactgagcaagctgaaggcattgaatgactttgtgaag
gtgagctcccagaagaccaccaagccccacaccaaggagatgatgcacatgtgtatgcgc
caggagacctacatggaggccctgtctcacctgcagtccccactggaccccagtaccctg
ctggaggaagtctgcagtgtggagcagtgcactttcatggactccaagatgaagccactg
tggatcatgtacagcagcgaggaggcgggcagtgctggcagcgtgggcatcatctttaag
aacggggatgacctccgccaggacatgctgactctgcagatgatccagctcatggacatc
ctgtggaagcaggagggcctggacctgaggatgaccccctatggctgcctccctactgga
gaccgcacaggcctcattgaggtggtcctccactctgacaccatcgccaacatccaactg
aacaagagcaacatggcagccacagccgccttcaacaaggatgccctgcttaactggctc
aagtctaagaaccctggggaggccctggaccgggccatcgaggaattcaccctgtcctgt
gctggctactgcgtagccacgtatgtgctggggatcggcgaccggcatagcgacaacatc
atgatccgagagagtgggcagctgttccatattgattttggccactttctggggaacttc
aagaccaagtttggaatcaaccgtgagcgagtcccattcatcctcacctatgactttgtg
cacgtcattcagcaggggaagactagtaacagtgagaagttcgaaaggttccggggctac
tgtgaacgagcctacaccattctgcggcgccacgggctgctcttcctccacctctttgcc
ctgatgcgtgcggcaggcctgcctgagctcagctgctccaaagacatccaatatctcaag
gactctctagcgctggggaagacagaggaagaagcactaaagcacttccgggtgaagttc
aatgaagctctgcgggagagctggaagaccaaagtgaactggttggcacacaacgtgtcc
aaagataacaggcagtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103738596
Entry
103738596         CDS       T03372                                 

Gene name
Pik3ca
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00562  Inositol phosphate metabolism
ngi01100  Metabolic pathways
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04210  Apoptosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04218  Cellular senescence
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04620  Toll-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04668  TNF signaling pathway
ngi04670  Leukocyte transendothelial migration
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04810  Regulation of actin cytoskeleton
ngi04910  Insulin signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04926  Relaxin signaling pathway
ngi04929  GnRH secretion
ngi04930  Type II diabetes mellitus
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi04960  Aldosterone-regulated sodium reabsorption
ngi04973  Carbohydrate digestion and absorption
ngi05010  Alzheimer disease
ngi05017  Spinocerebellar ataxia
ngi05020  Prion disease
ngi05100  Bacterial invasion of epithelial cells
ngi05132  Salmonella infection
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05146  Amoebiasis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05207  Chemical carcinogenesis - receptor activation
ngi05208  Chemical carcinogenesis - reactive oxygen species
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05415  Diabetic cardiomyopathy
ngi05417  Lipid and atherosclerosis
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103738596 (Pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103738596 (Pik3ca)
   04014 Ras signaling pathway
    103738596 (Pik3ca)
   04015 Rap1 signaling pathway
    103738596 (Pik3ca)
   04370 VEGF signaling pathway
    103738596 (Pik3ca)
   04630 JAK-STAT signaling pathway
    103738596 (Pik3ca)
   04668 TNF signaling pathway
    103738596 (Pik3ca)
   04066 HIF-1 signaling pathway
    103738596 (Pik3ca)
   04068 FoxO signaling pathway
    103738596 (Pik3ca)
   04070 Phosphatidylinositol signaling system
    103738596 (Pik3ca)
   04072 Phospholipase D signaling pathway
    103738596 (Pik3ca)
   04071 Sphingolipid signaling pathway
    103738596 (Pik3ca)
   04024 cAMP signaling pathway
    103738596 (Pik3ca)
   04151 PI3K-Akt signaling pathway
    103738596 (Pik3ca)
   04152 AMPK signaling pathway
    103738596 (Pik3ca)
   04150 mTOR signaling pathway
    103738596 (Pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103738596 (Pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    103738596 (Pik3ca)
   04218 Cellular senescence
    103738596 (Pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103738596 (Pik3ca)
   04550 Signaling pathways regulating pluripotency of stem cells
    103738596 (Pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103738596 (Pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103738596 (Pik3ca)
   04613 Neutrophil extracellular trap formation
    103738596 (Pik3ca)
   04620 Toll-like receptor signaling pathway
    103738596 (Pik3ca)
   04625 C-type lectin receptor signaling pathway
    103738596 (Pik3ca)
   04650 Natural killer cell mediated cytotoxicity
    103738596 (Pik3ca)
   04660 T cell receptor signaling pathway
    103738596 (Pik3ca)
   04662 B cell receptor signaling pathway
    103738596 (Pik3ca)
   04664 Fc epsilon RI signaling pathway
    103738596 (Pik3ca)
   04666 Fc gamma R-mediated phagocytosis
    103738596 (Pik3ca)
   04670 Leukocyte transendothelial migration
    103738596 (Pik3ca)
   04062 Chemokine signaling pathway
    103738596 (Pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103738596 (Pik3ca)
   04923 Regulation of lipolysis in adipocytes
    103738596 (Pik3ca)
   04929 GnRH secretion
    103738596 (Pik3ca)
   04915 Estrogen signaling pathway
    103738596 (Pik3ca)
   04914 Progesterone-mediated oocyte maturation
    103738596 (Pik3ca)
   04917 Prolactin signaling pathway
    103738596 (Pik3ca)
   04926 Relaxin signaling pathway
    103738596 (Pik3ca)
   04935 Growth hormone synthesis, secretion and action
    103738596 (Pik3ca)
   04919 Thyroid hormone signaling pathway
    103738596 (Pik3ca)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103738596 (Pik3ca)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103738596 (Pik3ca)
  09156 Nervous system
   04725 Cholinergic synapse
    103738596 (Pik3ca)
   04722 Neurotrophin signaling pathway
    103738596 (Pik3ca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103738596 (Pik3ca)
  09158 Development and regeneration
   04360 Axon guidance
    103738596 (Pik3ca)
   04380 Osteoclast differentiation
    103738596 (Pik3ca)
  09149 Aging
   04211 Longevity regulating pathway
    103738596 (Pik3ca)
   04213 Longevity regulating pathway - multiple species
    103738596 (Pik3ca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103738596 (Pik3ca)
   05206 MicroRNAs in cancer
    103738596 (Pik3ca)
   05205 Proteoglycans in cancer
    103738596 (Pik3ca)
   05207 Chemical carcinogenesis - receptor activation
    103738596 (Pik3ca)
   05208 Chemical carcinogenesis - reactive oxygen species
    103738596 (Pik3ca)
   05203 Viral carcinogenesis
    103738596 (Pik3ca)
   05230 Central carbon metabolism in cancer
    103738596 (Pik3ca)
   05231 Choline metabolism in cancer
    103738596 (Pik3ca)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103738596 (Pik3ca)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103738596 (Pik3ca)
   05212 Pancreatic cancer
    103738596 (Pik3ca)
   05225 Hepatocellular carcinoma
    103738596 (Pik3ca)
   05226 Gastric cancer
    103738596 (Pik3ca)
   05214 Glioma
    103738596 (Pik3ca)
   05221 Acute myeloid leukemia
    103738596 (Pik3ca)
   05220 Chronic myeloid leukemia
    103738596 (Pik3ca)
   05218 Melanoma
    103738596 (Pik3ca)
   05211 Renal cell carcinoma
    103738596 (Pik3ca)
   05215 Prostate cancer
    103738596 (Pik3ca)
   05213 Endometrial cancer
    103738596 (Pik3ca)
   05224 Breast cancer
    103738596 (Pik3ca)
   05222 Small cell lung cancer
    103738596 (Pik3ca)
   05223 Non-small cell lung cancer
    103738596 (Pik3ca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103738596 (Pik3ca)
   05170 Human immunodeficiency virus 1 infection
    103738596 (Pik3ca)
   05161 Hepatitis B
    103738596 (Pik3ca)
   05160 Hepatitis C
    103738596 (Pik3ca)
   05171 Coronavirus disease - COVID-19
    103738596 (Pik3ca)
   05164 Influenza A
    103738596 (Pik3ca)
   05162 Measles
    103738596 (Pik3ca)
   05168 Herpes simplex virus 1 infection
    103738596 (Pik3ca)
   05163 Human cytomegalovirus infection
    103738596 (Pik3ca)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103738596 (Pik3ca)
   05169 Epstein-Barr virus infection
    103738596 (Pik3ca)
   05165 Human papillomavirus infection
    103738596 (Pik3ca)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103738596 (Pik3ca)
   05135 Yersinia infection
    103738596 (Pik3ca)
   05100 Bacterial invasion of epithelial cells
    103738596 (Pik3ca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103738596 (Pik3ca)
   05142 Chagas disease
    103738596 (Pik3ca)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103738596 (Pik3ca)
   05017 Spinocerebellar ataxia
    103738596 (Pik3ca)
   05020 Prion disease
    103738596 (Pik3ca)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103738596 (Pik3ca)
   05418 Fluid shear stress and atherosclerosis
    103738596 (Pik3ca)
   05415 Diabetic cardiomyopathy
    103738596 (Pik3ca)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103738596 (Pik3ca)
   04932 Non-alcoholic fatty liver disease
    103738596 (Pik3ca)
   04931 Insulin resistance
    103738596 (Pik3ca)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103738596 (Pik3ca)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103738596 (Pik3ca)
   01524 Platinum drug resistance
    103738596 (Pik3ca)
   01522 Endocrine resistance
    103738596 (Pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103738596 (Pik3ca)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103738596 (Pik3ca)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103738596 (Pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ABC1 C2 Ribosomal_S15
Other DBs
NCBI-GeneID: 103738596
NCBI-ProteinID: XP_008836896
LinkDB
Position
Un
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREAMLVTIKHELFQEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFV
IGMPVCEFDMVKDPEVQDFRRNILSVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPTD
SFTMPSYSRRISTATPYMNGETPTKSLWVINSVLRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIHIPDLPRAARLCVSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRALCTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQEYTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccgcgaccgtcatcaggagaactgtggggcatccacttgatgcccccacgaatc
ctagtggagtgtttactcccaaacggaatgatagtgactttggagtgcctccgtgaggct
atgctagtcaccatcaagcacgaactgtttcaggaagccaggaaataccctctccaccag
cttctgcaggatgagtcttcttacattttcgtaagtgttacccaggaagcagaaagggaa
gaattttttgatgaaacaagacgcctttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaatcggttttgtt
attggcatgccagtgtgtgaatttgatatggttaaagatccggaagtccaagacttccga
cggaacattctgagtgtgtgcaaagaagccgtggacctgcgggatctgaactcccctcac
agcagagcaatgtatgtctaccctcccaatgtggagtcttccccagagctgccaaagcac
atttacaacaagttagataaaggacaaatcatagtagtgatttgggtcatagtctctcca
aataacgacaagcagaaatacactctgaagatcaaccatgactgtgtgccagagcaagtc
atcgctgaagcaatcaggaagaaaacccgcagtatgctgctgtcctcggagcagctgaag
ctctgcgtcctggagtaccagggcaagtacatcttgaaggtgtgtggctgcgatgagtac
ttcttggagaagtaccctctgagccagtataagtacataagaagctgtataatgctggga
aggatgcccaacttgatgctgatggccaaggaaagcctttattcccagctgccaaccgac
agcttcaccatgccatcctactctaggcgcatctccacagccacgccctacatgaatgga
gagacacctaccaagtccctctgggttataaatagcgtgctcagaatcaaaattctttgt
gcaacctatgtaaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagagcccttatgtgacaatgtgaacactcaaagagtaccttgttcaaat
cctaggtggaacgagtggctgaattacgacatacacattcccgaccttcctcgggctgct
cgactttgtgtttctatttgctctgttaaaggccggaagggcgcgaaggaggagcactgc
ccactggcctgggggaacataaacttgtttgattacacagacaccctggtatccgggaaa
atggctttgaacctctggccggtgccacatggtctggaagatctgctgaaccctattggt
gtcacagggtcaaatccaaataaggaaactccatgcttagagttggagtttgactggttc
agcagtgtggtgaagtttccagatatgtcggtgattgaagagcacgccaattggtctgtg
tctcgagaagctggattcagttactcccacgcaggactgagtaatagactagctagagac
aacgagctcagagaaaatgacaaagagcagctccgggcactctgtacccgagaccctctg
tcggaaatcactgagcaggagaaggacttcctgtggagccacagacactattgtgtaact
attcctgaaatcctacccaaactgcttctgtctgttaagtggaattccagagatgaagtg
gcccagatgtactgcttagtgaaagactggcctccaatcaaaccagagcaggccatggag
cttctagactgtaattatccagatcctatggttcggagttttgccgttcggtgcttggaa
aaatacttaacagacgacaagctttctcagtacctaatccagcttgtacaggtcctaaaa
tatgaacagtatttggataacctcctcgtgagatttttgctcaagaaagcattgacaaat
caaaggatcggccactttttcttttggcatttaaagtctgaaatgcacaacaagacagtc
agtcagaggttcggcctgctgctggagtcttactgccgtgcctgtgggatgtatctgaag
cacttgaacagacaggtggaggccatggagaagctcatcaacctgacagacatcctgaag
caggagaagaaggatgagacgcagaaggtgcagatgaagtttttagttgaacagatgagg
cagccagatttcatggatgccttgcagggctttctgtcccctctaaaccctgctcaccaa
ctagggaacctcaggcttgaagagtgtcggatcatgtcctctgcaaaaagaccactgtgg
ctgaactgggagaacccagacatcatgtcggagctgctgttccagaacaatgagatcatc
ttcaaaaatggcgatgatctgcggcaagacatgctgactcttcagatcatccgcatcatg
gagaacatctggcagaaccagggcctcgaccttcgaatgcttccttatggctgtctgtcg
attggggactgtgtggggctcattgaggtggtgaggaattctcataccatcatgcagatc
cagtgcaaaggaggcctgaagggggctctgcagttcaacagccacacgctgcatcagtgg
ctcaaggacaagaacaagggcgagatatacgatgcagccattgacctgttcacacgctca
tgcgctgggtactgcgtggccacattcatcctggggataggagatcgacataacagcaac
atcatggtgaaagacgatgggcagctgtttcatatagattttgggcactttctggatcac
aagaagaagaaatttggttataaacgggaacgtgtgccatttgttttgacacaagatttt
ttaatagtgattagtaaaggagcccaagaatacacaaagaccagagagtttgagaggttt
caggagatgtgttacaaggcttacctagctatccggcagcatgccaatctcttcatcaac
ctgttctccatgatgctcggctccgggatgcccgaactgcagtcctttgatgacattgcg
tatattcggaagactctcgccttggataaaactgagcaagaggctttggaatacttcaca
aaacaaatgaatgatgcacatcatggcggctggacgacaaaaatggattggatcttccac
actatcaagcagcacgctttgaactga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103738715
Entry
103738715         CDS       T03372                                 

Gene name
Pik3r1
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04210  Apoptosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04218  Cellular senescence
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04620  Toll-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04668  TNF signaling pathway
ngi04670  Leukocyte transendothelial migration
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04810  Regulation of actin cytoskeleton
ngi04910  Insulin signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04926  Relaxin signaling pathway
ngi04929  GnRH secretion
ngi04930  Type II diabetes mellitus
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi04960  Aldosterone-regulated sodium reabsorption
ngi04973  Carbohydrate digestion and absorption
ngi05010  Alzheimer disease
ngi05017  Spinocerebellar ataxia
ngi05020  Prion disease
ngi05100  Bacterial invasion of epithelial cells
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05146  Amoebiasis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05207  Chemical carcinogenesis - receptor activation
ngi05208  Chemical carcinogenesis - reactive oxygen species
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05415  Diabetic cardiomyopathy
ngi05417  Lipid and atherosclerosis
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103738715 (Pik3r1)
   04014 Ras signaling pathway
    103738715 (Pik3r1)
   04015 Rap1 signaling pathway
    103738715 (Pik3r1)
   04370 VEGF signaling pathway
    103738715 (Pik3r1)
   04630 JAK-STAT signaling pathway
    103738715 (Pik3r1)
   04668 TNF signaling pathway
    103738715 (Pik3r1)
   04066 HIF-1 signaling pathway
    103738715 (Pik3r1)
   04068 FoxO signaling pathway
    103738715 (Pik3r1)
   04070 Phosphatidylinositol signaling system
    103738715 (Pik3r1)
   04072 Phospholipase D signaling pathway
    103738715 (Pik3r1)
   04071 Sphingolipid signaling pathway
    103738715 (Pik3r1)
   04024 cAMP signaling pathway
    103738715 (Pik3r1)
   04151 PI3K-Akt signaling pathway
    103738715 (Pik3r1)
   04152 AMPK signaling pathway
    103738715 (Pik3r1)
   04150 mTOR signaling pathway
    103738715 (Pik3r1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103738715 (Pik3r1)
  09143 Cell growth and death
   04210 Apoptosis
    103738715 (Pik3r1)
   04218 Cellular senescence
    103738715 (Pik3r1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103738715 (Pik3r1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103738715 (Pik3r1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103738715 (Pik3r1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103738715 (Pik3r1)
   04613 Neutrophil extracellular trap formation
    103738715 (Pik3r1)
   04620 Toll-like receptor signaling pathway
    103738715 (Pik3r1)
   04625 C-type lectin receptor signaling pathway
    103738715 (Pik3r1)
   04650 Natural killer cell mediated cytotoxicity
    103738715 (Pik3r1)
   04660 T cell receptor signaling pathway
    103738715 (Pik3r1)
   04662 B cell receptor signaling pathway
    103738715 (Pik3r1)
   04664 Fc epsilon RI signaling pathway
    103738715 (Pik3r1)
   04666 Fc gamma R-mediated phagocytosis
    103738715 (Pik3r1)
   04670 Leukocyte transendothelial migration
    103738715 (Pik3r1)
   04062 Chemokine signaling pathway
    103738715 (Pik3r1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103738715 (Pik3r1)
   04923 Regulation of lipolysis in adipocytes
    103738715 (Pik3r1)
   04929 GnRH secretion
    103738715 (Pik3r1)
   04915 Estrogen signaling pathway
    103738715 (Pik3r1)
   04914 Progesterone-mediated oocyte maturation
    103738715 (Pik3r1)
   04917 Prolactin signaling pathway
    103738715 (Pik3r1)
   04926 Relaxin signaling pathway
    103738715 (Pik3r1)
   04935 Growth hormone synthesis, secretion and action
    103738715 (Pik3r1)
   04919 Thyroid hormone signaling pathway
    103738715 (Pik3r1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103738715 (Pik3r1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103738715 (Pik3r1)
  09156 Nervous system
   04725 Cholinergic synapse
    103738715 (Pik3r1)
   04722 Neurotrophin signaling pathway
    103738715 (Pik3r1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103738715 (Pik3r1)
  09158 Development and regeneration
   04360 Axon guidance
    103738715 (Pik3r1)
   04380 Osteoclast differentiation
    103738715 (Pik3r1)
  09149 Aging
   04211 Longevity regulating pathway
    103738715 (Pik3r1)
   04213 Longevity regulating pathway - multiple species
    103738715 (Pik3r1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103738715 (Pik3r1)
   05206 MicroRNAs in cancer
    103738715 (Pik3r1)
   05205 Proteoglycans in cancer
    103738715 (Pik3r1)
   05207 Chemical carcinogenesis - receptor activation
    103738715 (Pik3r1)
   05208 Chemical carcinogenesis - reactive oxygen species
    103738715 (Pik3r1)
   05203 Viral carcinogenesis
    103738715 (Pik3r1)
   05230 Central carbon metabolism in cancer
    103738715 (Pik3r1)
   05231 Choline metabolism in cancer
    103738715 (Pik3r1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103738715 (Pik3r1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103738715 (Pik3r1)
   05212 Pancreatic cancer
    103738715 (Pik3r1)
   05225 Hepatocellular carcinoma
    103738715 (Pik3r1)
   05226 Gastric cancer
    103738715 (Pik3r1)
   05214 Glioma
    103738715 (Pik3r1)
   05221 Acute myeloid leukemia
    103738715 (Pik3r1)
   05220 Chronic myeloid leukemia
    103738715 (Pik3r1)
   05218 Melanoma
    103738715 (Pik3r1)
   05211 Renal cell carcinoma
    103738715 (Pik3r1)
   05215 Prostate cancer
    103738715 (Pik3r1)
   05213 Endometrial cancer
    103738715 (Pik3r1)
   05224 Breast cancer
    103738715 (Pik3r1)
   05222 Small cell lung cancer
    103738715 (Pik3r1)
   05223 Non-small cell lung cancer
    103738715 (Pik3r1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103738715 (Pik3r1)
   05170 Human immunodeficiency virus 1 infection
    103738715 (Pik3r1)
   05161 Hepatitis B
    103738715 (Pik3r1)
   05160 Hepatitis C
    103738715 (Pik3r1)
   05171 Coronavirus disease - COVID-19
    103738715 (Pik3r1)
   05164 Influenza A
    103738715 (Pik3r1)
   05162 Measles
    103738715 (Pik3r1)
   05168 Herpes simplex virus 1 infection
    103738715 (Pik3r1)
   05163 Human cytomegalovirus infection
    103738715 (Pik3r1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103738715 (Pik3r1)
   05169 Epstein-Barr virus infection
    103738715 (Pik3r1)
   05165 Human papillomavirus infection
    103738715 (Pik3r1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103738715 (Pik3r1)
   05100 Bacterial invasion of epithelial cells
    103738715 (Pik3r1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103738715 (Pik3r1)
   05142 Chagas disease
    103738715 (Pik3r1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103738715 (Pik3r1)
   05017 Spinocerebellar ataxia
    103738715 (Pik3r1)
   05020 Prion disease
    103738715 (Pik3r1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103738715 (Pik3r1)
   05418 Fluid shear stress and atherosclerosis
    103738715 (Pik3r1)
   05415 Diabetic cardiomyopathy
    103738715 (Pik3r1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103738715 (Pik3r1)
   04932 Non-alcoholic fatty liver disease
    103738715 (Pik3r1)
   04931 Insulin resistance
    103738715 (Pik3r1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103738715 (Pik3r1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103738715 (Pik3r1)
   01524 Platinum drug resistance
    103738715 (Pik3r1)
   01522 Endocrine resistance
    103738715 (Pik3r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103738715 (Pik3r1)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103738715 (Pik3r1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_2 SH3_9 Laminin_I DUF4201 PI_PP_I Mod_r Lant_dehydr_C
Other DBs
NCBI-GeneID: 103738715
NCBI-ProteinID: XP_008837055
LinkDB
Position
Un
AA seq 724 aa
MSAEGYQYRALYDYRKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEDIGWLNGYN
ETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKTEADSEQQALTLPDLAE
QFAPPDIAPPLLIKLLETIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASVDLEMIDVQ
VLADAFKRYLLDLPNPVIPVAVYSEMMSLAQEVQSSEDFIQVLKKLIRSPNIPHQYWLTL
QYLLKHFFKLSQASSKNLLNPRVLSEIFSPMLFRFPATSSDNTEHFIKVIEVLISTEWNE
RQPAPALPPKPPKSTTVANNSMNNSMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENAEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgctgaggggtaccagtacagagctctgtatgactacaggaaggagagggaagaa
gacattgacctgcatttgggggacatactgactgtgaataaaggatccttggtggcactt
ggattcagtgatggacaggaagccaggcctgaagatattggctggttaaatggctataat
gaaaccactggggagaggggagactttccaggaacttacgtagaatatattggaaggaaa
agaatctcgcctcccactccaaaacccaggccacctcgacctcttcctgttgcaccaggt
tcctcaaaaactgaagcagatagtgaacaacaagctttgacccttcctgatctggctgag
cagtttgcccctcctgatatcgccccacctctccttatcaagctcctggaaaccatcgag
aagaaaggactggaatgttcgactctatacagaacacagagctccagtaaccctgcagaa
ttacgacagcttcttgattgtgatgctgcctccgtggacttggaaatgattgatgtgcaa
gttttagcagatgctttcaagcgctatcttctggacttaccaaatcctgtcattccagta
gctgtttacagtgaaatgatgtctttagcccaagaagtacaaagctctgaagacttcatc
caggtgttaaagaagctcattaggtcacctaatatacctcatcagtattggcttacactt
cagtatttgctaaaacatttcttcaagctgtctcaagcttccagcaaaaatcttttgaac
ccaagggtcctctctgaaattttcagccctatgcttttcagattcccagcaaccagctct
gataatactgaacacttcataaaagtaatagaagttttaatctcaactgaatggaatgaa
cgacagccagcaccagcactgccccctaagccacccaagtccaccactgtagccaacaac
agcatgaacaacagtatgtctttacaagatgctgaatggtactggggggatatctcaagg
gaagaagtaaatgaaaaactccgagacacagctgatgggacctttttggtacgagatgca
tctactaaaatgcatggcgactacactctcacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgtgatggaaaatacggcttctctgacccattaaccttcaattct
gtggttgaactgataaaccactaccggaatgagtctctagcccagtacaatcccaagctg
gatgtcaaattactttacccagtgtccaaataccaacaggatcaggttgtcaaagaagat
aatattgaagctgtagggaaaaagttacatgaatataacactcaatttcaagaaaaaagt
cgggaatatgatagattatatgaggaatacacccgcacttcccaggaaatccaaatgaaa
agaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaaacc
caagagcggtacagcaaagaatacattgaaaagtttaagcgtgaaggcaacgagaaggag
attcaaaggattatgcataattatgataagctaaagtctcgcatcagtgagatcattgat
agcagaagaaggttggaagaagacttgaagaagcaggcggccgagtatcgtgagattgac
aagcgcatgaacagcattaagccagacctcattcagctgagaaagacaagagaccaatac
ttgatgtggctgactcaaaaaggcgttcggcaaaagaagttgaacgaatggctgggaaat
gaaaacgcagaagaccaatattcactggtggaggatgatgaggacttgcctcaccatgac
gagaagacgtggaatgttggaagcagcaaccgaaacaaagctgaaaatctattgcgaggg
aagagagacggcacttttcttgtccgggagagcagtaagcaaggctgctacgcctgctct
gtagtggtagatggtgaagtcaagcattgtgtcatcaacaaaactgcgacaggctatggc
tttgcagagccctataacctgtacagctccctgaaggaactggtgctacattaccaacac
acctccctcgtgcagcacaatgactccctcaacgtcacactagcataccctgtatatgca
cagcagaggcgatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742946
Entry
103742946         CDS       T03372                                 

Gene name
Pik3cb
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00562  Inositol phosphate metabolism
ngi01100  Metabolic pathways
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04210  Apoptosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04218  Cellular senescence
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04620  Toll-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04668  TNF signaling pathway
ngi04670  Leukocyte transendothelial migration
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04810  Regulation of actin cytoskeleton
ngi04910  Insulin signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04926  Relaxin signaling pathway
ngi04929  GnRH secretion
ngi04930  Type II diabetes mellitus
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi04960  Aldosterone-regulated sodium reabsorption
ngi04973  Carbohydrate digestion and absorption
ngi05010  Alzheimer disease
ngi05017  Spinocerebellar ataxia
ngi05020  Prion disease
ngi05100  Bacterial invasion of epithelial cells
ngi05132  Salmonella infection
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05146  Amoebiasis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05207  Chemical carcinogenesis - receptor activation
ngi05208  Chemical carcinogenesis - reactive oxygen species
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05222  Small cell lung cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05415  Diabetic cardiomyopathy
ngi05417  Lipid and atherosclerosis
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103742946 (Pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103742946 (Pik3cb)
   04014 Ras signaling pathway
    103742946 (Pik3cb)
   04015 Rap1 signaling pathway
    103742946 (Pik3cb)
   04370 VEGF signaling pathway
    103742946 (Pik3cb)
   04630 JAK-STAT signaling pathway
    103742946 (Pik3cb)
   04668 TNF signaling pathway
    103742946 (Pik3cb)
   04066 HIF-1 signaling pathway
    103742946 (Pik3cb)
   04068 FoxO signaling pathway
    103742946 (Pik3cb)
   04070 Phosphatidylinositol signaling system
    103742946 (Pik3cb)
   04072 Phospholipase D signaling pathway
    103742946 (Pik3cb)
   04071 Sphingolipid signaling pathway
    103742946 (Pik3cb)
   04024 cAMP signaling pathway
    103742946 (Pik3cb)
   04151 PI3K-Akt signaling pathway
    103742946 (Pik3cb)
   04152 AMPK signaling pathway
    103742946 (Pik3cb)
   04150 mTOR signaling pathway
    103742946 (Pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103742946 (Pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    103742946 (Pik3cb)
   04218 Cellular senescence
    103742946 (Pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103742946 (Pik3cb)
   04550 Signaling pathways regulating pluripotency of stem cells
    103742946 (Pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103742946 (Pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103742946 (Pik3cb)
   04613 Neutrophil extracellular trap formation
    103742946 (Pik3cb)
   04620 Toll-like receptor signaling pathway
    103742946 (Pik3cb)
   04625 C-type lectin receptor signaling pathway
    103742946 (Pik3cb)
   04650 Natural killer cell mediated cytotoxicity
    103742946 (Pik3cb)
   04660 T cell receptor signaling pathway
    103742946 (Pik3cb)
   04662 B cell receptor signaling pathway
    103742946 (Pik3cb)
   04664 Fc epsilon RI signaling pathway
    103742946 (Pik3cb)
   04666 Fc gamma R-mediated phagocytosis
    103742946 (Pik3cb)
   04670 Leukocyte transendothelial migration
    103742946 (Pik3cb)
   04062 Chemokine signaling pathway
    103742946 (Pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103742946 (Pik3cb)
   04923 Regulation of lipolysis in adipocytes
    103742946 (Pik3cb)
   04929 GnRH secretion
    103742946 (Pik3cb)
   04915 Estrogen signaling pathway
    103742946 (Pik3cb)
   04914 Progesterone-mediated oocyte maturation
    103742946 (Pik3cb)
   04917 Prolactin signaling pathway
    103742946 (Pik3cb)
   04926 Relaxin signaling pathway
    103742946 (Pik3cb)
   04935 Growth hormone synthesis, secretion and action
    103742946 (Pik3cb)
   04919 Thyroid hormone signaling pathway
    103742946 (Pik3cb)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103742946 (Pik3cb)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103742946 (Pik3cb)
  09156 Nervous system
   04725 Cholinergic synapse
    103742946 (Pik3cb)
   04722 Neurotrophin signaling pathway
    103742946 (Pik3cb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103742946 (Pik3cb)
  09158 Development and regeneration
   04360 Axon guidance
    103742946 (Pik3cb)
   04380 Osteoclast differentiation
    103742946 (Pik3cb)
  09149 Aging
   04211 Longevity regulating pathway
    103742946 (Pik3cb)
   04213 Longevity regulating pathway - multiple species
    103742946 (Pik3cb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103742946 (Pik3cb)
   05206 MicroRNAs in cancer
    103742946 (Pik3cb)
   05205 Proteoglycans in cancer
    103742946 (Pik3cb)
   05207 Chemical carcinogenesis - receptor activation
    103742946 (Pik3cb)
   05208 Chemical carcinogenesis - reactive oxygen species
    103742946 (Pik3cb)
   05203 Viral carcinogenesis
    103742946 (Pik3cb)
   05230 Central carbon metabolism in cancer
    103742946 (Pik3cb)
   05231 Choline metabolism in cancer
    103742946 (Pik3cb)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103742946 (Pik3cb)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103742946 (Pik3cb)
   05212 Pancreatic cancer
    103742946 (Pik3cb)
   05225 Hepatocellular carcinoma
    103742946 (Pik3cb)
   05226 Gastric cancer
    103742946 (Pik3cb)
   05214 Glioma
    103742946 (Pik3cb)
   05221 Acute myeloid leukemia
    103742946 (Pik3cb)
   05220 Chronic myeloid leukemia
    103742946 (Pik3cb)
   05218 Melanoma
    103742946 (Pik3cb)
   05211 Renal cell carcinoma
    103742946 (Pik3cb)
   05215 Prostate cancer
    103742946 (Pik3cb)
   05213 Endometrial cancer
    103742946 (Pik3cb)
   05224 Breast cancer
    103742946 (Pik3cb)
   05222 Small cell lung cancer
    103742946 (Pik3cb)
   05223 Non-small cell lung cancer
    103742946 (Pik3cb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103742946 (Pik3cb)
   05170 Human immunodeficiency virus 1 infection
    103742946 (Pik3cb)
   05161 Hepatitis B
    103742946 (Pik3cb)
   05160 Hepatitis C
    103742946 (Pik3cb)
   05171 Coronavirus disease - COVID-19
    103742946 (Pik3cb)
   05164 Influenza A
    103742946 (Pik3cb)
   05162 Measles
    103742946 (Pik3cb)
   05168 Herpes simplex virus 1 infection
    103742946 (Pik3cb)
   05163 Human cytomegalovirus infection
    103742946 (Pik3cb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103742946 (Pik3cb)
   05169 Epstein-Barr virus infection
    103742946 (Pik3cb)
   05165 Human papillomavirus infection
    103742946 (Pik3cb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103742946 (Pik3cb)
   05135 Yersinia infection
    103742946 (Pik3cb)
   05100 Bacterial invasion of epithelial cells
    103742946 (Pik3cb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103742946 (Pik3cb)
   05142 Chagas disease
    103742946 (Pik3cb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103742946 (Pik3cb)
   05017 Spinocerebellar ataxia
    103742946 (Pik3cb)
   05020 Prion disease
    103742946 (Pik3cb)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103742946 (Pik3cb)
   05418 Fluid shear stress and atherosclerosis
    103742946 (Pik3cb)
   05415 Diabetic cardiomyopathy
    103742946 (Pik3cb)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103742946 (Pik3cb)
   04932 Non-alcoholic fatty liver disease
    103742946 (Pik3cb)
   04931 Insulin resistance
    103742946 (Pik3cb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103742946 (Pik3cb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103742946 (Pik3cb)
   01524 Platinum drug resistance
    103742946 (Pik3cb)
   01522 Endocrine resistance
    103742946 (Pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103742946 (Pik3cb)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103742946 (Pik3cb)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103742946 (Pik3cb)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 DUF4381 Tom37_C
Other DBs
NCBI-GeneID: 103742946
NCBI-ProteinID: XP_008842332
LinkDB
Position
Un
AA seq 1069 aa
MCFSFIMPPAMTDVLDIWAVDSQTAPDGSISVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPAE
KLDSKIGVLIGKGLHEFDSLKDPEVNEFRRKMRKFSEEKIQSLVGLSWIDWLKHTYPPEH
KPSILENLEDKLYGGKLIVAVHFENSQDVFSFQVSPNLNPIKINELAIQKRLTIRGKEDE
ASPYDFVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECSKIKKMYEQEMIAI
ESAINRNPSNLPLPLPPKKTRIISHVWDNNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPDNKKPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKEI
LDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKL
PPREALELLDFNYPDQYVREYAVSCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLL
ERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSIGHMKVLSKQVEALNKLKT
LNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMDS
KMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGC
LATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEEF
TLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILT
YDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDI
QYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3210 nt   +upstreamnt  +downstreamnt
atgtgcttcagcttcataatgcctcctgctatgacagacgtccttgacatctgggcagtg
gattcacagacagcacctgatggctccatatctgtggatttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctactatttcttacattaagcagatgttatgg
aagcaagttcacaattacccaatgtttaacctccttatggaaattgactcttacatgttt
gcatgtgtgaatcaaactgctgtgtatgaggaacttgaagatgaaacacgaaggctttgt
gatgtcagaccttttcttccagttctcaaattagtgactagaagttgtgaccctgcagaa
aaattggactcaaaaattggagtccttataggaaaaggtctgcatgaatttgattccttg
aaggatcctgaagtgaatgaatttcgaagaaaaatgcgtaaattcagtgaggaaaagatt
cagtctcttgtgggattatcgtggattgattggttaaagcatacatacccaccagagcac
aagccatccatcctggaaaacctggaagataaactttacggaggaaagctaatcgtggct
gttcattttgaaaatagccaggatgtgtttagctttcaagtatctcctaatttgaatccc
atcaaaataaatgaattggcaatccaaaaacgtttgactattcgtggaaaggaagatgaa
gccagtccctatgactttgtgttacaagtcagcgggagagtagaatatgtgtttggtgac
cacccactaattcagttccagtatatccggaactgtgtaatgaataggaccctgccccat
tttatcctcgtggaatgcagcaaaatcaagaaaatgtatgagcaagaaatgattgccata
gaatctgccataaatcgaaatccatccaaccttcctcttcctttaccaccaaagaaaaca
cgaattatttctcatgtttgggacaataacaatcctttccaaattgtcttggttaaggga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggctggtctttttcatgga
actgagctcctgtgtaaaaccattgtaagctcagagatatcaggaaaaaatgatcatatt
tggaatgaaccactggagtttgatattaatatctgtgacttaccaagaatggctcgatta
tgttttgctgtttatgcagttttggataaagtaaaaacaaagaagtcaactaaaactatt
aatccttctaaatatcagaccatcaggaaagctggaaaagtgcactatcctgtagcatgg
gtaaataccatggtctttgacttcaaaggacagttgaggtctggagatgtaatactgcac
agctggtcttcatttcctgatgagcttgaagagatgttgaatccaatgggaacggttcag
acgaatccgtatactgaaaatgccaccgctttgcatattaagtttccagacaataaaaaa
ccttactattaccctcccttcgataagattattgaaaaagcagccgagattgcgagcagt
gatagcgccaatgtatcaagtcgaggtggaaaaaagtttcttgctgtactgaaagaaatc
ctggaccgggatcccttgtctcagctgtgtgagaacgaaatggaccttatttggactttg
cgacaagactgcagagaaaatttcccacagtcactaccaaaattactcctgtcaatcaag
tggaataaacttgaagatgttgctcagcttcaggcactccttcagatttggcctaaactg
cctcccagggaagctctggagctcctggatttcaactatccagaccagtatgtccgggaa
tatgctgtgagctgcctacgacagatgagtgatgaagaactctctcaatatcttttacaa
ttggtgcaagttttaaaatatgagccttttcttgattgtgccctctctagatttctccta
gaaagagcacttgctaatcggaggatagggcagtttctattttggcatcttaggtcagag
gtgcatattcctgctgtgtctgtacagtttggtgtcattcttgaagcatactgtcgagga
agcataggacacatgaaagtgctttccaagcaggttgaagccctcaataaattaaaaact
ttaaacagcttaatcaaattaaatgccatgaagttaaacagagccaaaggaaaggaggcc
atgcatacctgtttaaagcagaatgcttaccgggaagccctctctgacctacagtcacct
ctgaatccatgtgtcatcctctcagagctctatgttgaaaagtgcaaatacatggattcc
aaaatgaagcctttgtggctggtctacaacaacaaagtatttggtgaggattcagttgga
gtgatttttaaaaatggtgatgatctacgacaggacatgttgacactccagatgctacgc
ttgatggatttactctggaaagaagctggtttggatcttcggatgctgccctatggctgt
ttagcaacaggagatcgctctggcctcattgaagttgtgagcacctcagagacaattgct
gacattcagctgaacagtagcaatgtagctgccgcagcagccttcaacaaagatgccctt
ctgaactggcttaaagaatacaactctggggatgatctagacagagcaattgaggagttt
accctgtcctgtgctggctactgtgtagcttcttatgtccttggaattggtgacagacac
agtgataacatcatggtgaagaaaactggccagctcttccacatagactttggacatatt
cttggaaatttcaaatctaaatttggcattaaaagggagcgagtaccttttattcttact
tatgacttcattcatgtcattcaacaaggaaaaacaggaaacacagaaaagtttggcaga
tttcgccagtgctgtgaagatgcatatctgattttacgaaggcatgggaatctcttcatt
accctgtttgcactgatgttgactgcagggcttcccgagctcacatcagtcaaagatata
cagtatcttaaggactctcttgccttaggaaagagtgaagaagaagcgctcaaacaattt
aagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaactggatggct
cacacagttcggaaagactacagatcctaa

DBGET integrated database retrieval system