KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103726892
Entry
103726892         CDS       T03372                                 

Gene name
Jak3
Definition
(RefSeq) Janus kinase 3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04062  Chemokine signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04217  Necroptosis
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi05161  Hepatitis B
ngi05162  Measles
ngi05166  Human T-cell leukemia virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05223  Non-small cell lung cancer
ngi05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103726892 (Jak3)
   04151 PI3K-Akt signaling pathway
    103726892 (Jak3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103726892 (Jak3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103726892 (Jak3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103726892 (Jak3)
   04659 Th17 cell differentiation
    103726892 (Jak3)
   04062 Chemokine signaling pathway
    103726892 (Jak3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103726892 (Jak3)
   05203 Viral carcinogenesis
    103726892 (Jak3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    103726892 (Jak3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103726892 (Jak3)
   05161 Hepatitis B
    103726892 (Jak3)
   05162 Measles
    103726892 (Jak3)
   05169 Epstein-Barr virus infection
    103726892 (Jak3)
  09163 Immune disease
   05340 Primary immunodeficiency
    103726892 (Jak3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103726892 (Jak3)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103726892 (Jak3)
Protein kinases [BR:ngi01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   103726892 (Jak3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl ABC1 pKID SH2 Kdo APH Haspin_kinase
Other DBs
NCBI-GeneID: 103726892
NCBI-ProteinID: XP_008822806
LinkDB
Position
Un
AA seq 1104 aa
MVPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPEPPQRLFFSFGDHLAEDLCVQAAKA
CGILPVYHSLFALATEDLSCWFPPSHIFSVEDSDTQVLVYRLRFYFPDWFGLETCHRFAL
RKDLAGAILDLHALEHLFAQHRSDLVSGRLPMGLSLNEQGECLSLAVLDLARMACEQAQR
PRELLRTVSYKFCLPPSLRDLIQGLSFVTRRRIRRTVSRALRRVAACQADRHSLMAKYII
DLERLYPAAAAETFHVGLPGAVGGQDSPGLLRVAGGSGISWSPGDPELFQPFCDFPEIVD
VSITQAPRVGPVAELRLVTVTRTDGHILEAEFPGLPHALSFVALVDGYFRLTCDPSHFFH
REVAPPRLLEEVAELCHGPITLDFAVHKLKAAGSVPGSYVLRRSPQDYDSFLLTVCVQTP
LGPDYKGCLIRRDPTGTFSLVGLSQPHSSLRELLAACWHAGLHIDGIALNLTSCCPPRPR
EKSNLVVIRRGCSPTPTSPGRAPVHCKLTQLTFHKIPLDTLEWQENLGHGSFTKIYRGRR
HEAVDGEAHDSEVLLKVMDARHRNYMESFLEAASLMSQVSYPHLVLLHGVCMAGDSTMVQ
EFVHLGAIDTYLRKRGHQVSASWKLQVTKQLAYALNYLEDKGFPHGNVSARKLLLAREGS
DGSPPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEPQTLGLEADKWGFGATVWEVFS
GIPMPLAALEPAKKLKFYEDHQQLPAPKWSELALLIQQCMAYDPGRRPSFRAILRDLNSL
ITSDYELLSDLTPGTLAPRDGLWSGTQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHNDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLHAGRLLLFAWQICKGMEYLGACRCVHRDLAARNILVESE
AHVKIADFGLAKLLPLGKDYYVVREPGQSPIFWYAPESLADNVFSRQSDVWSFGVLLYEL
FTYSDKNCSPSVEFLRMMGPEREGAALCRLLELLAEGRRLPAPPACPAEVHELMKLCWAP
SPEDRPAFSALGPQLDTLWRGSRG
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggtacctccaagtgaagagacacccctgatccctcaacgctcctgcagcctgtcatcc
tcagaggcaggagccctgcatgtacttctccctcctcggggccctgagcctccccaacga
ctgttcttttcctttggggaccacttggccgaggatctgtgtgtgcaggctgccaaggcc
tgtggcatcctgcccgtgtatcactcactgtttgctctggccactgaagacttgtcctgc
tggttccccccgagccacatcttctccgtggaggactcagacacccaagtcttggtctac
aggctgcgcttttacttccctgactggtttggcctggagacctgtcaccgctttgctctg
cgaaaagatttggcaggcgccatccttgacctgcatgctttagaacacctcttcgctcag
caccgcagtgacctggtgagtggccgccttcctatgggcctcagcctcaacgagcaaggg
gagtgcctgagcctggccgtgctggacctggcccggatggcttgtgagcaggcccagcgg
cccagggagctgctgaggactgtcagctacaagttctgcctgccgcccagcctgagggac
ctcatccagggcttgagcttcgtgacgcggaggcgcatccgcaggaccgtgagtcgcgcg
ttgcgccgcgtggccgcctgccaggcggaccggcactcgctcatggccaagtacatcata
gacctggagcggttatacccagcggccgccgccgagaccttccacgtggggctcccgggg
gcggtgggcggccaggattcacctgggctgctgcgcgtagcgggaggcagcggcatctcc
tggagtcccggagacccagagctttttcagcccttctgtgactttcccgaaatcgtggac
gtcagcatcacgcaagccccgagggtgggtccggtggcggagctccgactggtcacggtc
accaggacagacggccacatcctggaagccgagtttccggggctaccacacgcgctgtcc
ttcgtggctcttgtggatggctacttccgcctgacctgtgaccccagccacttcttccat
cgggaggtggctccaccccggctgctggaggaggtggcagaactgtgccatggccccatc
acgctggactttgctgtccacaagctcaaggcggcaggctccgtgccaggctcttacgtt
cttcgccgcagcccacaggactacgatagctttctcctcacagtctgtgtccagactccc
cttggcccagattacaagggctgcctcatccgacgggaccccacagggaccttctccctg
gttggcctcagccagccccacagcagtcttcgagaactcctggcagcctgctggcatgct
gggctacacatagatggcattgccttgaatctcacatcctgctgcccccccagacccaga
gaaaagtccaatttggttgtgatccggaggggctgcagcccaactcccacgtcccctggc
cgggccccagttcactgcaaactgacacagctgaccttccacaagatccccctggacacc
ctggagtggcaagagaacttgggccatgggtccttcaccaagatctaccgtggccggcgg
catgaggcagtggacggcgaggcccacgactcagaagtcctcctgaaagtgatggacgcc
aggcaccgaaactatatggagtcctttctggaagctgcaagtttgatgagtcaagtgtcc
taccctcacctcgtgttgctgcatggtgtctgcatggctggagacagcaccatggtgcag
gaatttgtgcacctgggagcgattgacacatacctacgtaagcgaggccaccaggtttcg
gccagttggaagcttcaggtgaccaagcagctggcctatgccctcaactacttggaggac
aaaggcttcccacatggcaacgtctcagcccggaagttgctcctggcacgagagggatct
gatgggagtccacccttcatcaagctgagtgaccctggtgtcagtcccactgtgctgagc
ctggaaatgctcacagacaggatcccctgggtggcccctgagtgtcttcaggagcctcag
acacttggcttggaggctgacaagtgggggtttggtgctacggtgtgggaggtgttcagt
ggcatacccatgcctcttgctgccctggagcctgccaagaaactcaagttttatgaggac
caccagcagctgccagcccccaagtggtctgagctggcactgctcatccagcagtgcatg
gcatatgaccctggccgacggccctccttccgtgccatcctgagagatctcaacagcctt
attacctcagattatgagcttctctcagacctgacccctggcaccctggcaccccgagac
gggctgtggagtggcacccagctctatgcctgccaggaccccaccatcttcgaagaaaga
caccttaagtacatctcgcagctgggcaagggcaactttggcagcgtggagctgtgtcgc
tacgaccctcttggggacaacacaggtgccctggtggccgtgaaacagttgcagcacagc
gggccagaccagcagagggacttccagcgggagatccagattctcaaggcgctgcacaac
gacttcatcgtcaagtaccgaggcgtcagctacgggccgggtcggcagagcctgcggctg
gtgatggagtacctgccgagcggctgtctgcgggacttcctgcagcgccatcgtgcgcgc
ctgcacgccggccgcctgctgttgttcgcctggcagatctgcaagggcatggagtacctt
ggcgcctgccgctgcgtacaccgcgacctggccgctcgcaacatcctggtggagagcgag
gcgcacgtcaagatcgccgactttggactcgccaagctgctgccgctagggaaggactac
tacgtggtccgcgagccgggacagagccccatcttctggtacgcccctgagtccctggcc
gacaacgtcttctcccgccagtcagacgtgtggagcttcggcgtactgctatatgaactc
ttcacctacagtgacaagaactgcagcccctcagttgagttcctgcgcatgatgggacca
gagcgggaaggggctgctctgtgtcgcctcctagagctgctggccgagggccgccgcttg
ccggcacctcccgcctgccccgccgaggttcacgagctcatgaagctgtgctgggcaccc
agccccgaggacaggccggccttcagtgcgctgggcccacagctggacactctgtggcgt
gggagccgcgggtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732475
Entry
103732475         CDS       T03372                                 

Gene name
Jak1
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04151  PI3K-Akt signaling pathway
ngi04217  Necroptosis
ngi04380  Osteoclast differentiation
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04621  NOD-like receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi05140  Leishmaniasis
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05212  Pancreatic cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103732475 (Jak1)
   04151 PI3K-Akt signaling pathway
    103732475 (Jak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103732475 (Jak1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103732475 (Jak1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103732475 (Jak1)
   04658 Th1 and Th2 cell differentiation
    103732475 (Jak1)
   04659 Th17 cell differentiation
    103732475 (Jak1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103732475 (Jak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103732475 (Jak1)
   05203 Viral carcinogenesis
    103732475 (Jak1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103732475 (Jak1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103732475 (Jak1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103732475 (Jak1)
   05161 Hepatitis B
    103732475 (Jak1)
   05160 Hepatitis C
    103732475 (Jak1)
   05171 Coronavirus disease - COVID-19
    103732475 (Jak1)
   05164 Influenza A
    103732475 (Jak1)
   05162 Measles
    103732475 (Jak1)
   05168 Herpes simplex virus 1 infection
    103732475 (Jak1)
   05163 Human cytomegalovirus infection
    103732475 (Jak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103732475 (Jak1)
   05169 Epstein-Barr virus infection
    103732475 (Jak1)
   05165 Human papillomavirus infection
    103732475 (Jak1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103732475 (Jak1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103732475 (Jak1)
   05140 Leishmaniasis
    103732475 (Jak1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103732475 (Jak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103732475 (Jak1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103732475 (Jak1)
Protein kinases [BR:ngi01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   103732475 (Jak1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 ABC1 SH2 TCAD9
Other DBs
NCBI-GeneID: 103732475
NCBI-ProteinID: XP_008829286
LinkDB
Position
Un
AA seq 1152 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVKQMVPEPGVEVTFYLLDREPLRLGSGEYTAEEL
CIRAAQECSISPLCHNLFALYDESTKLWYAPNRIITVDDKLSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLIKCLAPIRDPRTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WGNSSDSGNVLYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLEYKHKKDEEKNKVRE
EWNNFSYFPEITHIVIKKSVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAHH
YLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTC
FEKSEVLGGQKQFKNFQIEVQKGRYSLHGSVDHFPSLRDLMNHLKKQILRTDNISFVLKR
CCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIIQGEHLGRGTRTHIYSGTL
MDYKDDEGTAEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVE
NIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLL
AREGIDSEIGPFIKLSDPGIPVSVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTT
LWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIM
RDINKLEEQNPDIVSEKKPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTG
EQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPSG
SLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDF
GLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDF
SPMALFLKMIGPTHGQMTVTRLVSTLKEGKRLPCPPNCLDEVYQLMRKCWEFQPSNRTTF
QNLIEGFEALLK
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgcagtatctaaacataaaagaggactgcaatgccatggcgttctgtgctaagatgagg
agctccaagaagactgaagtgaagcaaatggtccctgagcctggggtggaagtgaccttc
tatctgttggacagggagccactccgcttgggcagtggggagtatactgctgaggagctg
tgcatcagggccgcgcaggaatgcagtatttctcctctgtgccacaatctctttgcactg
tatgatgagagcactaagctctggtatgctccgaaccgcatcatcactgtggacgacaag
ctgtctctccggctccactaccgcatgaggttctacttcaccaactggcatggaaccaac
gacaatgagcaatctgtgtggcgacattctccaaagaaacagaaaaatggctatgagaag
aaaaaggttccagatgcaaccccactccttgatgccagctcactggagtatctgtttgcg
cagggacagtatgatttaatcaaatgcctggctcccattcgggatcccaggactgagcag
gatggacacgacattgagaacgagtgtctggggatggctgtgctggctatctcacactat
gccatgatgaagaagatgcagctgccagagctgcccaaagacatcagctacaagcggtat
attccagaaacattgaataaatccatcagacagaggaaccttcttaccaggatgcgaata
aataatgttttcaaagatttcctgaaggaatttaacaacaagaccatctgtgacagcagt
gtgtccacgcatgacctgaaggtgaaatacctcgccaccttggagacactgacaaagcat
tatggggctgagatatttgagacttccatgttactgatttcatcagagaatgagatgaat
tggggcaactcaagtgacagtggcaatgttctttatgaagtgatggtgactggaaatctt
ggaatccagtggcggcagaaaccaaacgttgttcctgttgaaaaggaaaaaaataaactg
aagcggaaaaaactggaatataaacacaagaaggatgaggaaaaaaacaaagtccgggaa
gagtggaacaatttttcatacttccctgaaattactcacattgtcataaagaagtctgtg
gtcagcattaacaaacaggacaacaaaaaaatggaactgaagctttcttctcatgaggag
gccttgtcctttgtgtccctggtagatggctacttccggctcacagcagatgcccaccat
tacctctgcacagatgtggctcccccactaattgtccacaacatacagaatggctgtcac
ggtcctatctgcacagaatatgccatcaataagctgcggcaagaagggagcgaagagggg
atgtatgtgctgagatggagctgcaccgactttgacaacatccttatgaccgtcacctgc
tttgagaagtctgaggtattgggaggccagaaacaattcaagaactttcagatcgaggta
cagaagggccgctacagcctgcatggctcggttgaccactttcccagcctgagagacctc
atgaaccatctcaagaagcagatcctccgcacagacaacataagctttgtgctgaaacgt
tgctgtcagcccaagccccgagagatctccaatctgctggtagccactaagaaagcacag
gaatggcaacctgtctatcccatgagccagctgagttttgatcggatcctcaagaaagac
attatacaaggtgagcacctcggcagaggcacaagaacacatatctactctgggaccctg
atggactacaaggatgatgaagggactgctgaagagaagaagataaaagtcatcctcaag
gtcttagatcccagccacagggacatttctctggccttctttgaggcggccagcatgatg
cggcaggtttcccacaaacacatcgtatacctttatggtgtctgtgtccgagatgtggag
aatatcatggtagaagagtttgtggagggaggaccactagatctcttcatgcacaggaaa
agcgatgtcctcactacaccctggaagttcaaagttgccaaacaactggccagtgccctg
agttacttggaagataaagatctagttcatggaaatgtgtgtaccaaaaatcttcttctg
gcccgtgagggaattgacagtgagattggcccgttcatcaagctcagtgaccctggcatc
cctgtctctgtgctatccaggcaagaatgcatagagagaatcccctggattgctcctgag
tgtgttgaagactccaagaatctgagtgtggctgctgacaaatggagctttggaaccaca
ctctgggaaatctgctacaatggagagatcccccttaaagacaagaccctgattgagaag
gaaagattctatgaaagccgttgcaggccagtgactccatcttgcaaggagctagctgat
ctcatgacccgctgcatgaactatgaccccaatcaaagacctttcttccgagccatcatg
agggacatcaacaagctggaagagcagaatccagacattgtgtcagaaaagaagccaaca
acagaggtggatcccactcattttgaaaagcgtttcttgaagaggattcgtgacttggga
gagggccactttgggaaggtggagctctgcaggtatgaccctgaaggggacaatacaggg
gagcaggtggctgtcaagtccttgaaacctgagagtggaggtaaccacatagctgacttg
aagaaggagatagaaatcttaaggaacctgtaccatgagaacattgtgaagtacaaagga
atctgcatggaagatggagggaatggtatcaagctcatcatggaatttctgccctcggga
agcctaaaggagtatcttccaaagaataagaacaaaattaacctgaaacagcagctaaaa
tatgccatccagatctgtaaggggatggactatttgggttctcgtcaatatgttcaccgg
gacctagctgcaagaaatgtccttgttgagagtgaacaccaagtaaagattggagacttt
ggtctaaccaaagcaatagaaactgataaggagtactacacagtcaaggacgaccgggac
agtcccgtgttttggtatgctccagaatgtttaatccagtgtaaattttatatcgcctct
gacgtctggtcttttggagtgacgctgcatgagctacttacttactgtgattcagacttt
agtcccatggctctgttcctgaaaatgataggcccgacccacggccagatgacagtaaca
cgacttgtgagtacactgaaagagggaaagcgcctgccatgtccacccaattgccttgac
gaggtttatcaacttatgagaaaatgttgggaattccagccctctaaccggacaactttt
cagaaccttattgaaggatttgaagcgttgttaaaataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103740979
Entry
103740979         CDS       T03372                                 

Gene name
Jak2
Definition
(RefSeq) Janus kinase 2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04062  Chemokine signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04217  Necroptosis
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04725  Cholinergic synapse
ngi04917  Prolactin signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi05140  Leishmaniasis
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05161  Hepatitis B
ngi05164  Influenza A
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05200  Pathways in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103740979 (Jak2)
   04151 PI3K-Akt signaling pathway
    103740979 (Jak2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103740979 (Jak2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103740979 (Jak2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103740979 (Jak2)
   04659 Th17 cell differentiation
    103740979 (Jak2)
   04062 Chemokine signaling pathway
    103740979 (Jak2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103740979 (Jak2)
   04917 Prolactin signaling pathway
    103740979 (Jak2)
   04935 Growth hormone synthesis, secretion and action
    103740979 (Jak2)
  09156 Nervous system
   04725 Cholinergic synapse
    103740979 (Jak2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103740979 (Jak2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103740979 (Jak2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103740979 (Jak2)
   05164 Influenza A
    103740979 (Jak2)
   05168 Herpes simplex virus 1 infection
    103740979 (Jak2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103740979 (Jak2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103740979 (Jak2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103740979 (Jak2)
   05140 Leishmaniasis
    103740979 (Jak2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103740979 (Jak2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103740979 (Jak2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103740979 (Jak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103740979 (Jak2)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103740979 (Jak2)
Protein kinases [BR:ngi01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   103740979 (Jak2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl ABC1 RIO1 Kinase-like APH
Other DBs
NCBI-GeneID: 103740979
NCBI-ProteinID: XP_008839879
LinkDB
Position
Un
AA seq 1132 aa
MGMACLTMTEMEATSTPPVHQNGDIPGNASSVKQVDPVLQVYLYHSLGKAEGVYLKFPTG
EYVAEEICVAASKACGITPVYHNMFALMSEAERIWYPPNHVFHIDESTSHNILYRIRFYF
PHWYCSGSNRTYRYGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
MAVLDMMRIAKEKDQTPLAIYNSISYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIQQF
SQCKATARNLKLKYLINLETLQSAFYTEQFEVKESARGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPDIIDVSIKQANQECSNESRIVTIHKQDGKILEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFDKYFLTFAVERDNIIEYKHCLITKNENREYNLSGTKRNFSSLKDLLNC
YRMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVHISPTLQRHNNVNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGIRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLGVAKQLAWA
MHFLEEKSLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDKHQLPAPKWTEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPVEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPEGCPDEIYIIMTECWNNNVNQRPSFRDLALRVDQIRDSMAA
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgggaatggcttgccttacaatgacagaaatggaagcaacttccacacctcctgtacat
cagaatggagatattcctggaaatgctagttctgtgaagcaagtagatccagtccttcag
gtatatctgtaccactcccttggaaaagctgaaggagtttatctgaagtttccaactgga
gagtatgttgcagaagaaatttgtgttgctgcttctaaagcttgtggtattacacctgtg
tatcataatatgtttgctttaatgagtgaagcagaaagaatctggtatccacccaaccat
gtcttccacatagatgagtcaaccagccataatatactctacagaataagattttacttt
cctcactggtattgcagtggcagcaacagaacctatcgatacggaatatctcgtggggct
gaagcacctcttcttgatgactttgtcatgtcttacctctttgctcagtggcggcatgat
tttgtgcatggatggataaaagtacctgtgactcatgaaacacaggaagaatgtcttggg
atggcggtgttagatatgatgcgaatagctaaagagaaggatcagacacccctggctatc
tacaattccatcagctataagacattcttaccaaaatgcgttcgagcaaagatccaagac
taccatattttgacccggaagcgaataaggtaccgatttcgcagatttattcagcagttc
agtcaatgcaaagccactgccaggaacttgaaacttaagtatcttataaatctggaaact
cttcagtctgccttctacacagagcaatttgaagtaaaagaatctgcaagaggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaaagtgagacactgacagaacaggatttacagttatattgtgatttt
cctgatattattgatgtcagtattaagcaagcaaaccaggaatgctcaaatgaaagtaga
attgtaactatccataagcaagatgggaaaattttggaaattgaacttagctcattaaga
gaagctttgtcatttgtatcattaattgatggatattatagactaactgcagatgcacac
cattacctctgtaaagaagtagcaccaccagcagtgcttgagaatatacagagcaactgt
catggcccaatttcaatggattttgcaattagtaaactgaagaaagcgggtaatcagact
ggattatatgtacttcgatgtagtcctaaggactttgataaatattttctgacctttgct
gttgagcgagataatatcattgaatataagcattgtttgattacaaagaatgagaacaga
gagtacaacctcagtgggactaagaggaacttcagcagtcttaaagaccttctgaactgc
taccggatggaaactgttcgctcagacaatataattttccagtttactaaatgctgtccc
ccaaagccaaaagataagtcaaaccttctagtcttcagaacaaatggtgtttctgatgtt
cacatctcaccaacgttacagaggcataataatgtgaaccaaatggtgttccacaaaatc
agaaatgaagatttgatatttaatgaaagccttggccaaggtacttttaccaaaattttt
aaaggtataagaagagaagtaggagattatggtcagctgcatgaaacagaagttcttttg
aaagttctggataaagcacatagaaactattcagagtctttctttgaagcagcaagcatg
atgagtcagctttctcacaagcatttggttttgaattacggagtatgtgtctgtggagag
gagaatattctggttcaagagtttgttaaatttggatcactagatacgtatctgaaaaaa
aataaaaattccataaacatattatggaaactcggagtggctaaacagttggcatgggca
atgcattttctagaagagaaatcccttattcacggaaatgtatgtgccaaaaatattcta
cttatcagagaagaagataggaaaacaggaaatcctcctttcatcaaacttagtgaccct
ggcatcagcattacagttttaccaaaggacattcttcaggagagaataccttgggtacca
cctgaatgtattgaaaatcccaaaaatctaaatctggcaacagacaaatggagttttggt
accactctgtgggaaatttgcagtggaggagataagcctctaagtgctctggattctcaa
agaaagctacagttttatgaagataagcatcagcttcctgcaccaaagtggacagaatta
gcaaaccttataaataattgcatggattatgaaccagatttcaggccttctttcagagcc
atcatacgagatcttaacagtttgtttactccggattatgaactattaacagaaaatgac
atgctaccaaacatgagaataggtgccctaggattttctggtgcttttgaagacagagac
cctacacagtttgaggagagacatttgaaatttctacagcaactcggcaagggtaacttt
gggagtgtggagatgtgccgctatgaccccctacaagacaacactggagaggtggtggct
gttaaaaagctacagcacagcacggaagagcacctcagggattttgaaagggaaattgaa
atcctgaaatccttgcagcatgacaacattgtaaagtacaagggagtatgctacagtgct
ggtcggcgtaacctaagattaattatggaatatttgccatatggaagtttacgggactat
ctccaaaaacataaagaacggatcgatcacaaaaaacttctgcagtacacatctcagata
tgcaagggtatggagtatcttggtacaaaaaggtatatccacagagacctagcaacaaga
aatatattggtggaaaatgagaaccgagttaaaattggagattttggattaaccaaagtc
ttgccacaagacaaagaatactacaaagtaaaagaaccaggtgaaagccccatattctgg
tatgctccagaatcactgaccgagagcaagttttctgtggcctcagatgtttggagtttt
ggtgtggttctgtatgaacttttcacatatattgagaagagtaaaagtccaccagtggaa
tttatgcgaatgattggcaatgacaagcaaggacagatgattgtgttccatctgatagag
ctcctgaagaataatgggagattgccaaggcctgaagggtgcccagatgagatatatatt
atcatgacagaatgctggaacaacaatgtaaatcagcgtccctccttcagggacctggca
cttcgagtggatcaaatacgggacagtatggctgcgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747562
Entry
103747562         CDS       T03372                                 

Gene name
Tyk2
Definition
(RefSeq) tyrosine kinase 2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04217  Necroptosis
ngi04380  Osteoclast differentiation
ngi04621  NOD-like receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi05145  Toxoplasmosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103747562 (Tyk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103747562 (Tyk2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103747562 (Tyk2)
   04658 Th1 and Th2 cell differentiation
    103747562 (Tyk2)
   04659 Th17 cell differentiation
    103747562 (Tyk2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103747562 (Tyk2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    103747562 (Tyk2)
   05160 Hepatitis C
    103747562 (Tyk2)
   05171 Coronavirus disease - COVID-19
    103747562 (Tyk2)
   05164 Influenza A
    103747562 (Tyk2)
   05162 Measles
    103747562 (Tyk2)
   05168 Herpes simplex virus 1 infection
    103747562 (Tyk2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103747562 (Tyk2)
   05169 Epstein-Barr virus infection
    103747562 (Tyk2)
   05165 Human papillomavirus infection
    103747562 (Tyk2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103747562 (Tyk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103747562 (Tyk2)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103747562 (Tyk2)
Protein kinases [BR:ngi01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   103747562 (Tyk2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kdo Kinase-like
Other DBs
NCBI-GeneID: 103747562
NCBI-ProteinID: XP_008848270
LinkDB
Position
Un
AA seq 1185 aa
MPLCHRGAEAKARKAVGEEAQPMVTTGGLTVLLHWAGPEGREPWVTFSQTSLTVEDICIQ
IAHKVGITPPCLNLFALYDAQAQVWLPPNHVLDTSQSTNLTLYFRMRFYFRNWHGMNPQE
PAVYRCGFPGAETSSDRTDQGVQLLDSASFEYLFEQGKHEFVNDVISLRDLSSEEEIHYF
KNESLGMAFLHLCHLALSREVSLQEVAREISFKDCIPRSFRQQICQHNALTRLRLRRVFR
RFLRAFRPGHLSQQVVMVKYLATLERLAPRFGSELLPVYHLEILAQAERDPCYFQNSGPV
PGDLGPEVTTGPPTHEVLVTGTGGIQWRLVQTQASESDGGRVPQTSSSGKKAKALSAGEN
AVEKPQKPAWSYFCDFQDISHMVLKDQRVRVHRQDNKCLELTLPSRAAALSFVALVDGYF
RLTADSSHYLCHEVAPPRLVLSIRDGIHGPLLDSFVQAKLRPEDGLFLIHWSTSHLHRLI
LTVAQHDPAQGSGPQSLRLRKFPIAQQPGAFVLEGWDRSFASVGDLRVALQGCSLRAGDD
CFPLRHCCLPQPGELSNLLIMRGSRAHTRPLNLSQLSFHRIRQDEITQLSHLGQGTRTNV
YEGLLRVGGPEEGKVDSGYPPEPGGGSGQELRVVLKVLDPSHHDIALAFYETASLMSQVS
HMHLAFLHGVCVRGSENIIVTEFVEHGPLDVWLRRQRGQVPMTWKVAVAQQLASALSYLE
DKKLVHGNVCGRNILLARLGVEEDTSPFIKLSDPGVGLGALSREEQVERIPWTAPECLTG
EAGSLSTAADKWGFGATLLEICFDGEAPLQGRSPSEKERFYLKQHHLPDPSCPEMATLTS
QCLTYEPAQRPSFRTILRDLTRLQPQNLVDVSAVNADSPASDPTVFHKRYLKKIRDLGEG
HFGKVSLYCYDPANDGTGEMVAVKALKDGSGPQLRSGWWREIEILRTLYHEHIVKYKGCC
EDQGEKSVQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEPCPQGMAYLHSQRYIHR
DLAARNVLLDHNTLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYAS
DVWSFGVTLYELLTNCDSSQSPPTKFIELIGLTQGQMTVLRLTELLERGERLPRPDRCPC
EIYLLMKNCWESEASFRPTFQNLIPILKTAQEKYQGQAPSVFSVC
NT seq 3558 nt   +upstreamnt  +downstreamnt
atgcctctgtgtcatcggggagctgaggcaaaagccaggaaggcagttggtgaagaagct
caacccatggtcactacaggaggcctcacagtgctgctgcactgggctggcccagagggt
cgagaaccctgggtcaccttcagccagacatctctgactgtggaggacatctgtatccag
atcgcacacaaagtgggaatcactcctccctgcctcaatctcttcgccctctacgatgcc
caggctcaggtctggctgccaccaaaccatgtcctggacacatcccaaagtacaaacctg
acgctgtattttcgtatgaggttctacttccggaactggcatggcatgaatccccaggag
ccggctgtataccgctgtggtttcccaggggcagagacttcctcagaccggacagaccag
ggggtccagctcctggactctgcctcatttgagtatctctttgagcagggtaagcacgag
tttgtgaatgacgtgatttccctccgggatctgtcaagcgaggaagagatccactatttt
aagaacgagagtctaggcatggcctttctgcacctctgccaccttgctctcagccgtgaa
gtctccctgcaggaggtggccagagagatcagcttcaaggactgcatccctcgctccttc
cgccagcagatctgtcaacacaatgctctcacacgtctgcgccttcgcagagtcttccgc
cgcttcctgcgggccttcaggcctggccacctttcccagcaggtcgtgatggtcaaatac
ctggccaccctggagcgcctggcacctcgattcggttcagagctccttcctgtgtatcac
ctggagatactggcccaggctgagagggacccctgctacttccagaatagtggaccagtc
cctggggacctgggcccagaggtgaccactgggcctcccactcacgaggtactggtgacg
ggaaccggaggaatccagtggcggctggtacagacccaggcgtctgagagtgatggtggc
agggttccccaaaccagctcatctgggaagaaagccaaggccctcagtgctggggagaat
gcagtggagaagccacagaaaccggcctggtcctacttctgtgacttccaggacatctcc
cacatggtgctgaaggatcagcgtgtccgtgtacacaggcaggacaacaagtgcctggag
ctgaccctgccttccagggctgcggccctgtcctttgtcgccctggtggatggctacttc
cgcttgaccgcagactccagccactacctgtgccatgaggtggcacccccgcggctggtg
ctgagcatccgggacggcatccatgggccactgctggactcatttgtgcaggccaagttg
cggccggaggatggtctcttcctcatccactggagcaccagtcacctgcatcggctgatt
ctcacagtggcccagcatgacccggcacaaggcagtggccctcagagcctccgcctccgc
aagtttcccattgctcagcagcctggggcatttgtcctggaaggctgggatcgctccttt
gccagcgtgggggacctcagggtggctttgcagggctgttctctgcgggctggagatgac
tgcttccctctgcgacactgctgtctgccccagccgggagaactgtccaacctcctgatc
atgagggggtctcgcgcccataccaggccactcaacctcagccagctcagcttccacagg
attcgtcaagatgaaatcacgcaactatcccacttgggccagggtacaagaaccaatgta
tatgagggccttctgcgagtagggggccctgaggaaggcaaagtggacagtgggtatccc
cctgaacctggtgggggcagcgggcaggagctccgtgtggtgcttaaagtcctcgacccc
agtcaccatgacatcgcattggccttctacgagacagctagcctcatgagccaggtgtct
cacatgcacctggctttcctgcatggtgtttgtgtgcgtggttcagagaacatcatcgta
actgagtttgtagaacatggtcccttggatgtgtggctgcgacgacaaaggggccaggtg
cccatgacctggaaggtggctgtggctcaacagcttgccagtgccctcagttacctggag
gacaagaaactggttcacgggaatgtgtgtggccggaatatcctgctggcccggctgggg
gtggaggaggacaccagccccttcatcaagctcagcgacccaggcgtgggcttaggtgcc
ctttccagggaagagcaggtggaacgcatcccctggacagctcccgagtgcctaactgga
gaggccggtagtttgagcaccgctgccgacaaatggggttttggtgccaccctcctcgag
atctgcttcgatggggaggcaccactccagggccgtagcccctccgagaaggagcgattc
tatctgaagcagcaccatctgcctgatccctcgtgtccagagatggccacgctcaccagc
cagtgtctaacctatgagccagcccagcggccgtcattccgtaccatcctgcgtgacctc
actcggctacaaccgcagaacctggtggatgtctcagctgtaaatgcagactcaccggcc
tctgatcccacagttttccacaagcgttatttgaaaaaaatccgggacctaggagagggt
cactttggcaaggtcagcctgtactgttatgacccagccaatgatggcaccggggagatg
gtggctgtaaaagcccttaaagacggatctggcccccagctccgctcaggctggtggagg
gagattgaaatcctacggactctgtaccacgaacacattgtcaagtacaaaggctgctgt
gaggaccaaggggagaagtctgtgcagctggtcatggaatacgtccctctgggcagcctc
cgtgactatctaccccgccacagcgtggggttggcacagctcttgctcttcgcccagcag
atctgtgagccctgcccccagggcatggcctacctgcattcccagcgctacatccatcga
gacctagctgcgcgcaatgtgctgctggaccacaacacgctggtcaagatcggagacttt
ggcctggccaaggcagtgcctgaaggccatgaatactaccgcgtgcgcgaggacggcgac
agcccggtgttctggtatgcacccgagtgcctgaaggaatgtaaattttactatgcatct
gatgtctggtcttttggggtgaccctgtatgagctgctgacaaactgtgactccagccag
agccccccgacgaaattcatcgaactcatcggcctcacccagggccagatgacagtgctg
aggctcacagagcttctggaacgaggagagaggctaccacggccagacagatgtccctgc
gagatctatcttctcatgaaaaactgctgggaatcagaggcctcattccgccccaccttc
cagaacctcatccctatcctgaagacagcccaggagaagtaccaaggccaggccccttct
gtgttcagtgtgtgctga

DBGET integrated database retrieval system