KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727073
Entry
103727073         CDS       T03372                                 

Gene name
Camk1g
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IG
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04020  Calcium signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi05214  Glioma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103727073 (Camk1g)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103727073 (Camk1g)
   04925 Aldosterone synthesis and secretion
    103727073 (Camk1g)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    103727073 (Camk1g)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103727073 (Camk1g)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103727073 (Camk1g)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   103727073 (Camk1g)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo APH FTA2 RIO1 Pkinase_fungal YrbL-PhoP_reg 5_nucleotid
Other DBs
NCBI-GeneID: 103727073
NCBI-ProteinID: XP_017651520
LinkDB
Position
Un
AA seq 472 aa
MDSTTLLHSAADPLSASTLEAMGRKEEEDCSSWKKQTTNIRKTFIFMEVLGSGAFSEVFL
VKQRATGKLFALKCMKKSPAFRDSSLENEIAVLKRIKHENIVTLEDIYESTTHYYLVMQL
VSGGELFDRILERGVYTEKDASVVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENSK
IMITDFGLSKMEQNGVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVITYILHEIWSLA
VSLMFPLAKDFICHLLEKDPNERYTCEKALRHPWIDGNTALHRDIYPSVSLQIQKNFAKS
KWRQAFNAAAVVHHMKKLHMNLHSVRPEVENRPPVSPGPEASRPGSHDSTITEAPVLDPS
TPLPALTRLPCPHSSRPAAPGGRSLNCLVNGSLRISSSLVPMQQGPLATGPCGCCSSCLN
IGNKEKSSYCSEPTLLRKANKKQNFKSEVMVSVKAGGSSHCRAGQTGVCLIM
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggatagtacaacgctccttcacagcgctgcagatcccctgtcagcttcaactctggag
gcgatgggtcgaaaagaggaggaggactgtagttcctggaagaaacagaccaccaacatc
cggaaaaccttcatcttcatggaagtgctggggtcaggcgcgttctcagaagtgttcctg
gtgaagcaaagagcgactgggaaactcttcgccctgaagtgcatgaagaagtcaccggcc
ttccgggacagcagcctagagaacgagattgctgtgttgaaaaggatcaagcatgagaac
atcgtgaccttggaggacatctatgagagtactacccactactacctggtcatgcagctt
gtttctggtggggagctctttgaccggatcctagagcgtggtgtctacacagagaaggat
gccagtgtggtgatccagcaggtcttgtctgcagtgaaatacctccatgagaacggcatc
gtccacagagacctaaagccggaaaacctgttgtacctcacccctgaggagaactccaag
atcatgatcactgactttggtctgtctaagatggagcagaacggagtcatgtccacagcc
tgtgggaccccgggctacgtggctccagaagtgctggcccagaagccttacagcaaggct
gtggactgctggtccatcggcgtcatcacatacatacttcatgaaatctggtccttagct
gtgtctctaatgttccccttagctaaagattttatttgccacctgctggagaaggaccca
aatgaacggtacacctgtgagaaggccctcaggcacccctggattgatgggaacactgcc
ctgcaccgggacatctacccatctgtcagccttcagatccagaagaactttgccaagagc
aagtggaggcaagccttcaatgcggccgcagtcgtgcaccacatgaagaagctccacatg
aacctgcacagcgtccgtccagaggtggagaacaggccaccagtgtccccaggccccgaa
gcctccagaccaggctcccatgacagcaccatcacggaggcccctgtcctggacccgagc
acccccctccctgcactgacccgactgccctgcccacacagctcccggccagcagcccct
ggaggccgctcactcaactgtctggtcaacggctccctgcgcatcagcagcagcctggtg
cccatgcagcaggggcccctggccactgggccctgcggctgctgctccagctgccttaac
atcgggaacaaagagaagtcctcctactgctcagagcccaccctcctaagaaaggccaac
aaaaaacagaatttcaagtcagaggtcatggtgtcagtgaaagccggcggcagctcccac
tgccgggctgggcagactggagtctgcctcatcatgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734983
Entry
103734983         CDS       T03372                                 

Gene name
Camk2b
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04012  ErbB signaling pathway
ngi04020  Calcium signaling pathway
ngi04024  cAMP signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04114  Oocyte meiosis
ngi04217  Necroptosis
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04740  Olfactory transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04916  Melanogenesis
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04934  Cushing syndrome
ngi04971  Gastric acid secretion
ngi05012  Parkinson disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05031  Amphetamine addiction
ngi05152  Tuberculosis
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05214  Glioma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103734983 (Camk2b)
   04310 Wnt signaling pathway
    103734983 (Camk2b)
   04066 HIF-1 signaling pathway
    103734983 (Camk2b)
   04020 Calcium signaling pathway
    103734983 (Camk2b)
   04024 cAMP signaling pathway
    103734983 (Camk2b)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103734983 (Camk2b)
   04217 Necroptosis
    103734983 (Camk2b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103734983 (Camk2b)
   04922 Glucagon signaling pathway
    103734983 (Camk2b)
   04912 GnRH signaling pathway
    103734983 (Camk2b)
   04921 Oxytocin signaling pathway
    103734983 (Camk2b)
   04916 Melanogenesis
    103734983 (Camk2b)
   04925 Aldosterone synthesis and secretion
    103734983 (Camk2b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103734983 (Camk2b)
  09154 Digestive system
   04971 Gastric acid secretion
    103734983 (Camk2b)
  09156 Nervous system
   04725 Cholinergic synapse
    103734983 (Camk2b)
   04728 Dopaminergic synapse
    103734983 (Camk2b)
   04720 Long-term potentiation
    103734983 (Camk2b)
   04722 Neurotrophin signaling pathway
    103734983 (Camk2b)
  09157 Sensory system
   04740 Olfactory transduction
    103734983 (Camk2b)
   04750 Inflammatory mediator regulation of TRP channels
    103734983 (Camk2b)
  09158 Development and regeneration
   04360 Axon guidance
    103734983 (Camk2b)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103734983 (Camk2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103734983 (Camk2b)
   05205 Proteoglycans in cancer
    103734983 (Camk2b)
  09162 Cancer: specific types
   05214 Glioma
    103734983 (Camk2b)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103734983 (Camk2b)
   05022 Pathways of neurodegeneration - multiple diseases
    103734983 (Camk2b)
  09165 Substance dependence
   05031 Amphetamine addiction
    103734983 (Camk2b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103734983 (Camk2b)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103734983 (Camk2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103734983 (Camk2b)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103734983 (Camk2b)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   103734983 (Camk2b)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 SnoaL_2 APH Pkinase_fungal Kdo SnoaL_4
Other DBs
NCBI-GeneID: 103734983
NCBI-ProteinID: XP_008832290
LinkDB
Position
Un
AA seq 549 aa
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGATMGLVEQAKSLLNKKADGVKPQTNSTK
NSSAITSPKGSLPPAALEPQTTVIHNPVDGIKESSDSTNTTIEDEDAKVTPVSPAARKQE
IIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKP
IHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHC
SGAPVAPLQ
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggccaccacggtgacctgcacccgattcaccgacgagtatcagctctacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgcacaggccatgagtat
gcagccaagatcatcaacaccaagaagctgtcggccagagatcaccagaaactggagaga
gaggctcggatttgccgcctgctgaagcattcaaacattgttcgtctccatgacagcatc
tctgaagaggggttccactacctggttttcgatctggtcactggtggggagctctttgaa
gacattgtggcaagagagtactacagtgaggctgatgccagtcactgcatccagcagatc
ctggaggctgttctccattgtcaccaaatgggggtcgtccacagagacctcaagcctgag
aacctgcttctggccagcaagtgcaaaggggccgcggtgaagctggcagacttcggcctg
gccatcgaggtgcagggggaccagcaggcatggtttggatttgctggcacgccgggctac
ctgtcccctgaggtccttcggaaggaggcatatggcaaacctgtggacatctgggcatgt
ggggtgatcctgtacatcctgttggtgggctacccgcccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggctggggcctatgacttcccatcccctgaatgggacacc
gttactcctgaagccaaaaacctcatcaaccagatgttgactatcaaccctgccaagcgc
atcacggcccatgaggccctgaagcacccatgggtctgtcaacgctcaacggtggcctct
atgatgcacagacaggagactgtggaatgtctgaagaagttcaatgccaggaggaagctc
aagggggccatcctcaccactatgctggcaacacggaatttctcagtgggcagacagacc
accgctccagccacaatgtccaccgcggcctccggcgccaccatggggctggtggaacaa
gccaagagtttactcaacaagaaggcagatggagtcaagccccagacaaacagcaccaaa
aacagctcggccatcaccagccccaaaggatcgctccctcctgctgccctggagcctcaa
accaccgttatccataacccagtggacgggattaaggagtcttccgacagcaccaacaca
accatagaagatgaagatgccaaagtcacccctgtttcccctgcagcccggaagcaggaa
atcatcaagaccacagagcagctcatcgaggctgtcaacaatggcgactttgaggcctat
gcgaaaatctgtgacccaggcctgacctcatttgagcccgaagctctgggcaacctggtc
gaagggatggatttccacagattctacttcgagaacctgctggccaagaacagcaagccg
atccacacgaccatcctgaacccacacgtgcacgtcattggtgaggacgcagcctgcatc
gcctacatccgcctcacgcagtatatagacgggcagggccggccccgcaccagccagtcc
gaagagacccgcgtgtggcaccgccgagatggcaagtggcagaatgtacacttccactgc
tcgggagcgccggtggccccactgcagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736933
Entry
103736933         CDS       T03372                                 

Gene name
Camk2g
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04012  ErbB signaling pathway
ngi04020  Calcium signaling pathway
ngi04024  cAMP signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04114  Oocyte meiosis
ngi04217  Necroptosis
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04740  Olfactory transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04916  Melanogenesis
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04934  Cushing syndrome
ngi04971  Gastric acid secretion
ngi05012  Parkinson disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05031  Amphetamine addiction
ngi05152  Tuberculosis
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05214  Glioma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103736933 (Camk2g)
   04310 Wnt signaling pathway
    103736933 (Camk2g)
   04066 HIF-1 signaling pathway
    103736933 (Camk2g)
   04020 Calcium signaling pathway
    103736933 (Camk2g)
   04024 cAMP signaling pathway
    103736933 (Camk2g)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103736933 (Camk2g)
   04217 Necroptosis
    103736933 (Camk2g)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103736933 (Camk2g)
   04922 Glucagon signaling pathway
    103736933 (Camk2g)
   04912 GnRH signaling pathway
    103736933 (Camk2g)
   04921 Oxytocin signaling pathway
    103736933 (Camk2g)
   04916 Melanogenesis
    103736933 (Camk2g)
   04925 Aldosterone synthesis and secretion
    103736933 (Camk2g)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103736933 (Camk2g)
  09154 Digestive system
   04971 Gastric acid secretion
    103736933 (Camk2g)
  09156 Nervous system
   04725 Cholinergic synapse
    103736933 (Camk2g)
   04728 Dopaminergic synapse
    103736933 (Camk2g)
   04720 Long-term potentiation
    103736933 (Camk2g)
   04722 Neurotrophin signaling pathway
    103736933 (Camk2g)
  09157 Sensory system
   04740 Olfactory transduction
    103736933 (Camk2g)
   04750 Inflammatory mediator regulation of TRP channels
    103736933 (Camk2g)
  09158 Development and regeneration
   04360 Axon guidance
    103736933 (Camk2g)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103736933 (Camk2g)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103736933 (Camk2g)
   05205 Proteoglycans in cancer
    103736933 (Camk2g)
  09162 Cancer: specific types
   05214 Glioma
    103736933 (Camk2g)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103736933 (Camk2g)
   05022 Pathways of neurodegeneration - multiple diseases
    103736933 (Camk2g)
  09165 Substance dependence
   05031 Amphetamine addiction
    103736933 (Camk2g)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103736933 (Camk2g)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103736933 (Camk2g)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103736933 (Camk2g)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103736933 (Camk2g)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   103736933 (Camk2g)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Pkinase_fungal SnoaL_2 Kdo RIO1
Other DBs
NCBI-GeneID: 103736933
NCBI-ProteinID: XP_008834771
LinkDB
Position
Un
AA seq 571 aa
MYSLRGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLH
DSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDL
KPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDI
WACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINP
AKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSVG
RQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSLVSPAQE
PAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSMPEGRSSRDR
TAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGN
LVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTS
QSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgtacagcctgaggggtgctttctctgtggtccgcaggtgtgtgaagaaaacctcaacg
caagaatatgcagcaaaaatcatcaataccaagaagttatcagcccgagatcatcagaaa
ctagagcgagaggcccggatatgccgacttttgaaacatccaaacattgtgcgcctccat
gacagtatttctgaagaagggtttcactacctcgtgtttgaccttgttactggcggggag
ctgtttgaagacatcgtggccagagaatactacagtgaagcagatgccagccactgtata
catcagattctggagagtgttaaccacattcaccagcatgacattgtccacagggacctg
aagcctgagaacttactgttggcgagtaaatgcaagggtgctgcagtcaagctggctgat
tttggcctcgccatcgaagtgcaaggagagcagcaggcatggtttggttttgctggcacc
ccaggttacttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtggatatc
tgggcctgcggggtcatcctgtatatcctcctggtgggctaccctcccttctgggatgag
gatcagcacaagctgtatcagcagatcaaagctggagcctacgatttcccatcaccagaa
tgggacacagtgactcccgaagccaagaacttgatcaaccagatgctgaccataaaccca
gctaagcgtatcacagctgaccaggctctcaaacacccatgggtctgtcaacgatccaca
gtggcttccatgatgcatcgccaagagaccgtggagtgcttgcgcaaattcaatgcccgg
agaaaactgaagggtgccatcctcacaaccatgcttgtctccaggaacttttcagttggc
aggcagagctccgcccccgcctcccctgccgcgagcgccgccggcctggccgggcaagct
gccaaaagcctattgaacaagaagtcagatggcggtgtcaagaaaaggaagtcgagttcc
agcgtgcacctaatgccacagagcaacaacaaaaacagtctcgtaagcccagcccaagag
cccgcgcccttgcagacggccatggagccacaaaccaccgtagtgcacaatgctacagat
gggatcaagggctctacagagagctgcaacaccactacagaagatgaagacctcaaagct
gccccgctccgcactgggaatggcagctcgatgcctgaaggacggagctcccgggacaga
acagccccctctgcaggcatgcagccccagccttctctctgctcctcagccatgcgaaaa
caggagatcattaagatcacagaacagctgatcgaagccatcaacaatggagattttgag
gcctacacgaaaatttgtgatccaggcctcacttcctttgaacctgaggcccttggtaac
ctcgtggaggggatggatttccataagttttactttgagaatctcctgtctaagaacagc
aagcccatccataccaccatcctcaacccacatgtccacgtgattggggaggacgcagct
tgcatcgcctacatccgtctcacccagtacatcgacgggcagggtcggcctcgtaccagc
cagtcagaggagacccgggtgtggcaccgccgggacggcaagtggctcaatgtccactat
cattgttcaggggcccctgctgcaccgctgcagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743264
Entry
103743264         CDS       T03372                                 

Gene name
Camk2d
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04012  ErbB signaling pathway
ngi04020  Calcium signaling pathway
ngi04024  cAMP signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04114  Oocyte meiosis
ngi04217  Necroptosis
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04740  Olfactory transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04916  Melanogenesis
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04934  Cushing syndrome
ngi04971  Gastric acid secretion
ngi05012  Parkinson disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05031  Amphetamine addiction
ngi05152  Tuberculosis
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05214  Glioma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103743264 (Camk2d)
   04310 Wnt signaling pathway
    103743264 (Camk2d)
   04066 HIF-1 signaling pathway
    103743264 (Camk2d)
   04020 Calcium signaling pathway
    103743264 (Camk2d)
   04024 cAMP signaling pathway
    103743264 (Camk2d)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103743264 (Camk2d)
   04217 Necroptosis
    103743264 (Camk2d)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103743264 (Camk2d)
   04922 Glucagon signaling pathway
    103743264 (Camk2d)
   04912 GnRH signaling pathway
    103743264 (Camk2d)
   04921 Oxytocin signaling pathway
    103743264 (Camk2d)
   04916 Melanogenesis
    103743264 (Camk2d)
   04925 Aldosterone synthesis and secretion
    103743264 (Camk2d)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103743264 (Camk2d)
  09154 Digestive system
   04971 Gastric acid secretion
    103743264 (Camk2d)
  09156 Nervous system
   04725 Cholinergic synapse
    103743264 (Camk2d)
   04728 Dopaminergic synapse
    103743264 (Camk2d)
   04720 Long-term potentiation
    103743264 (Camk2d)
   04722 Neurotrophin signaling pathway
    103743264 (Camk2d)
  09157 Sensory system
   04740 Olfactory transduction
    103743264 (Camk2d)
   04750 Inflammatory mediator regulation of TRP channels
    103743264 (Camk2d)
  09158 Development and regeneration
   04360 Axon guidance
    103743264 (Camk2d)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103743264 (Camk2d)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743264 (Camk2d)
   05205 Proteoglycans in cancer
    103743264 (Camk2d)
  09162 Cancer: specific types
   05214 Glioma
    103743264 (Camk2d)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103743264 (Camk2d)
   05022 Pathways of neurodegeneration - multiple diseases
    103743264 (Camk2d)
  09165 Substance dependence
   05031 Amphetamine addiction
    103743264 (Camk2d)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103743264 (Camk2d)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103743264 (Camk2d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103743264 (Camk2d)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103743264 (Camk2d)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   103743264 (Camk2d)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 Pkinase_fungal Kdo SnoaL_2 SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 103743264
NCBI-ProteinID: XP_008842718
LinkDB
Position
Un
AA seq 512 aa
MASTATCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKINSKANVVTSPKENIPTPALEPQTTVIHNPDG
NKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALG
NLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPRT
MQSEETRVWHRRDGKWQNVHFHRSGSPTVPIK
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggcttccacggccacctgcactaggttcaccgacgagtatcagctcttcgaggagctc
ggaaagggggcattctcagtggtgagaagatgtatgaaaatccctactggacaagagtat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcaccagaaattggaaagg
gaagctagaatctgccgtcttttgaagcaccccaacattgtgagacttcatgacagtata
tcagaagaaggcttccactatctggtgtttgatttagttactggaggtgagctgtttgaa
gacatagtggcaagagagtactatagtgaggccgatgccagtcattgtatacagcagatt
ctagaaagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagccagtaaatccaagggagcagctgtgaaactggcagactttggctta
gccatagaggttcaaggagaccagcaagcatggtttggttttgctggtacacctggatat
ctttctccagaagttttgcgtaaagatccttatggaaagccagtggatatgtgggcatgt
ggtgtcattctctacatcctgctggtagggtatccacccttctgggatgaagaccaacac
agactctatcagcagatcaaggctggagcatatgattttccgtcaccagaatgggacacg
gtgactcctgaagccaaagatctcatcaacaaaatgctgaccatcaaccctgctaaacgt
atcacagcctcggaggctctgaaacacccatggatctgtcaacgttctactgttgcctcc
atgatgcacagacaggagactgtcgactgcctgaagaagtttaatgctagacggaaactg
aagggtgccatcttgacaactatgctggctacgaggaatttttcagcagccaagagtttg
ttgaagaaaccagatggagtaaagataaacagcaaagccaacgtggtaaccagccccaaa
gaaaatatccccaccccagcgctggagccccaaactactgtaatccacaaccctgatgga
aacaaggagtcaactgagagctcaaataccaccattgaggatgaagatgtaaaagcacga
aagcaagagatcatcaaagtcactgagcaactgattgaagctatcaacaatggagacttc
gaggcgtacacaaaaatctgtgacccaggccttactgcctttgaacctgaagctttgggc
aacttagtggaagggatggacttccaccgattctactttgaaaatgctttgtccaaaagc
aataaaccaattcacactatcatcctgaaccctcacgtgcacctggtgggggacgacgcg
gcctgcatagcatacatccggctgacacagtacatggacggcagtgggatgccaaggaca
atgcagtcggaagagacgcgtgtgtggcaccgccgggatggaaagtggcagaacgttcac
tttcatcgctcagggtcaccaacagtacccatcaagtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746367
Entry
103746367         CDS       T03372                                 

Gene name
Camk1d
Definition
(RefSeq) calcium/calmodulin dependent protein kinase ID
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04020  Calcium signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi05214  Glioma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103746367 (Camk1d)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103746367 (Camk1d)
   04925 Aldosterone synthesis and secretion
    103746367 (Camk1d)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    103746367 (Camk1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103746367 (Camk1d)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103746367 (Camk1d)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   103746367 (Camk1d)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo RIO1 APH Pkinase_fungal 5_nucleotid Tyrosinase Pox_ser-thr_kin Hypoth_Ymh
Other DBs
NCBI-GeneID: 103746367
NCBI-ProteinID: XP_008846751
LinkDB
Position
Un
AA seq 385 aa
MARENGESSSSWKKQAEDIKMIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALK
GKESSIENEIAVLRRIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRRLHLGSSLDGSNASVSSNLSLASQKDCLAPSTLCSFISSS
SGVSEVEAERRPRPTTVTTVHTGSK
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggccagggagaatggcgagagcagctcctcctggaaaaagcaagccgaagacatcaag
atgatcttcgagttcaaggagaccctcggaaccggggccttttctgaagtggttttagct
gaggaaaaagcaactggaaaactcttcgcagtgaagtgcatccctaagaaggcactgaag
gggaaggagagcagcatcgagaatgagatcgccgttcttagaaggatcaagcatgaaaac
attgttgccctggaagatatttatgaaagccctaatcacctgtatttggtcatgcagctt
gtatctggtggagagctctttgatcgaattgtggagaagggattttacacagagaaagat
gccagcactctgatccgccaggtcctggatgctgtatactatcttcacagaatgggcatc
gttcacagggacctcaagcctgaaaatctcttgtactacagtcaagatgaggagtccaaa
ataatgatcagcgactttggcttgtcaaagatggagggcaaaggagatgtcatgtccaca
gcctgtgggaccccaggctatgttgctcctgaggttctcgcccagaaaccctacagcaaa
gctgttgactgctggtccatcggcgtgatcgcctacatcttactctgcggctaccctcct
ttttatgatgaaaatgactcaaagctctttgaacagatcctcaaagcagaatatgagttt
gattccccctactgggatgacatctctgattctgcaaaggacttcattcgaaatctgatg
gagaaagacccaaataaaagatacacctgtgagcaggcagctcggcacccctggattgct
ggtgacacagccctcaacaaaaacattcatgagtcggtcagcgcccagatccggaagaat
tttgcaaaaagcaaatggagacaagcgtttaatgccacagccgttgtgagacatatgaga
aggctacacctcggtagcagcctggatggttcaaatgcaagtgtttcaagcaacctcagt
ttggccagccaaaaagattgtctggcaccttccacgctctgtagtttcatttcttcttcg
tcgggggtctcagaagtcgaagctgagaggagacccaggcccaccactgtgactacagtg
cacactggaagcaagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747079
Entry
103747079         CDS       T03372                                 

Gene name
Camk2a
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04012  ErbB signaling pathway
ngi04020  Calcium signaling pathway
ngi04024  cAMP signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04114  Oocyte meiosis
ngi04217  Necroptosis
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04728  Dopaminergic synapse
ngi04740  Olfactory transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04916  Melanogenesis
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04934  Cushing syndrome
ngi04971  Gastric acid secretion
ngi05012  Parkinson disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05031  Amphetamine addiction
ngi05152  Tuberculosis
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05214  Glioma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103747079 (Camk2a)
   04310 Wnt signaling pathway
    103747079 (Camk2a)
   04066 HIF-1 signaling pathway
    103747079 (Camk2a)
   04020 Calcium signaling pathway
    103747079 (Camk2a)
   04024 cAMP signaling pathway
    103747079 (Camk2a)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103747079 (Camk2a)
   04217 Necroptosis
    103747079 (Camk2a)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103747079 (Camk2a)
   04922 Glucagon signaling pathway
    103747079 (Camk2a)
   04912 GnRH signaling pathway
    103747079 (Camk2a)
   04921 Oxytocin signaling pathway
    103747079 (Camk2a)
   04916 Melanogenesis
    103747079 (Camk2a)
   04925 Aldosterone synthesis and secretion
    103747079 (Camk2a)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103747079 (Camk2a)
  09154 Digestive system
   04971 Gastric acid secretion
    103747079 (Camk2a)
  09156 Nervous system
   04725 Cholinergic synapse
    103747079 (Camk2a)
   04728 Dopaminergic synapse
    103747079 (Camk2a)
   04720 Long-term potentiation
    103747079 (Camk2a)
   04722 Neurotrophin signaling pathway
    103747079 (Camk2a)
  09157 Sensory system
   04740 Olfactory transduction
    103747079 (Camk2a)
   04750 Inflammatory mediator regulation of TRP channels
    103747079 (Camk2a)
  09158 Development and regeneration
   04360 Axon guidance
    103747079 (Camk2a)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103747079 (Camk2a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747079 (Camk2a)
   05205 Proteoglycans in cancer
    103747079 (Camk2a)
  09162 Cancer: specific types
   05214 Glioma
    103747079 (Camk2a)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103747079 (Camk2a)
   05022 Pathways of neurodegeneration - multiple diseases
    103747079 (Camk2a)
  09165 Substance dependence
   05031 Amphetamine addiction
    103747079 (Camk2a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103747079 (Camk2a)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103747079 (Camk2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103747079 (Camk2a)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103747079 (Camk2a)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   103747079 (Camk2a)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Kdo Pkinase_fungal SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 103747079
NCBI-ProteinID: XP_008847608
LinkDB
Position
Un
AA seq 478 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggccaccattacctgcacccgattcacagaagagtaccagctctttgaggaactggga
aagggagccttctcagtggtacgcaggtgtgtgaaggtgctggctggccaggagtatgct
gccaagatcatcaacaccaagaagctctcggccagagaccatcagaagctggagcgcgag
gcccgaatctgccgcttgctgaagcatcccaacattgtccgactccatgacagcatctct
gaggaggggcaccactaccttatcttcgacctggtcactggaggggagctgtttgaagat
attgtagcccgggagtattacagcgaggctgatgccagtcactgtatccagcagatcctg
gaggctgtgctgcactgtcaccagatgggggtggtgcaccgggacctgaagcctgagaat
ctgttgctggcctccaagctcaagggtgctgctgtgaagctggcagactttggcctggcc
atagaggtggaaggggagcaacaggcatggtttgggttcgcagggacacccggatacctc
tccccagaagtgctgcggaaggacccatacgggaagcctgtggacctgtgggcctgtggg
gtcatcctgtacatcttgctggttgggtaccccccattctgggatgaggaccagcaccgc
ctgtaccagcagatcaaagctggcgcctatgatttcccctcaccggaatgggacactgtc
accccagaagctaaggatctgatcaataagatgctgaccatcaatccatccaaacgtatt
acagctgctgaggccctcaaacacccctggatctcgcaccgatccaccgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaatgccaggaggaaactcaag
ggagccattctcaccactatgctggccaccaggaacttctctggagggaagagtggggga
aacaagaagaacgatggtgtgaaggaatcttctgagagcaccaacaccaccattgaggat
gaagacaccaaagtgcgcaaacaggaaattataaaagtgacagagcagctgattgaagcc
ataagcaatggagattttgagtcctacacgaagatgtgcgaccctggaatgacagccttt
gaacccgaggccctggggaacctggttgagggcctggacttccatcgattctattttgaa
aacctgtggtccaggaacagcaagcccgtgcacaccaccatcctgaatccccacatccat
ctgatgggcgatgagtcggcctgcattgcctatatccgcatcacgcagtacctggatgca
ggtggcattccccgcacagcccagtcagaggagacccgtgtgtggcatcgccgggatggc
aaatggcaaattgtccacttccacagatctggggcaccgtccgtcctgcctcactga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751418
Entry
103751418         CDS       T03372                                 

Gene name
Camk1
Definition
(RefSeq) calcium/calmodulin dependent protein kinase I
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04020  Calcium signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi05214  Glioma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103751418 (Camk1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103751418 (Camk1)
   04925 Aldosterone synthesis and secretion
    103751418 (Camk1)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    103751418 (Camk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103751418 (Camk1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103751418 (Camk1)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   103751418 (Camk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH RIO1 Tyrosinase
Other DBs
NCBI-GeneID: 103751418
NCBI-ProteinID: XP_008853064
LinkDB
Position
Un
AA seq 369 aa
MPGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKE
GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR
LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPDSVLSTACG
TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP
YWDDISDSAKDFIQHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
SKWKQAFNATAVVRHMRKLQLGTSQEGQGQASHGELLTPTTGGSAARCCCRDCCVEPRPE
LPPAFPPQL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgccaggggcagtggaaggccccaggtggaagcaggcggaggacattagggacatctat
gacttccgagatgttctgggcacgggtgctttctcagaggtgattctggcagaggacaag
aggactcagaaactggtggccatcaaatgcatcgccaagaaggccctggagggcaaagag
ggcagcatggagaatgagattgctgtcttgcacaagatcaagcaccccaacattgtagct
ctggatgacatctatgagagtgggggccacctctacctcatcatgcagctggtttcagga
ggggagctgtttgaccgcatcgtggagaaaggattctacacggaacgggatgctagccgc
ctcatcttccaggtgttggatgctgtcaagtacctgcatgacctgggcattgtgcaccgg
gacctcaagccagagaacctgctgtactatagcctggatgaagactctaaaatcatgatc
tccgactttggcctctccaagatggaggacccggacagtgtgctctccacagcctgtggg
accccaggctacgtggctcctgaggtcctggctcagaagccctacagcaaggccgtggac
tgctggtccataggagtcattgcatatatcctgctctgcggctacccccctttctatgac
gagaacgatgccaaactctttgaacagattttgaaggccgagtacgagtttgactctcct
tactgggacgacatctctgactctgccaaagatttcatacagcacttgatggagaaagat
ccagagaagaggttcacctgtgagcaggccttgcagcacccgtggattgcaggagataca
gctctagataagaacatccaccagtcagtgagtgagcagatcaagaagaactttgccaag
agcaagtggaagcaagctttcaatgccactgctgtggtgcggcacatgaggaagctgcag
ctgggcaccagccaagaggggcagggacaggcaagccacggggagctactgacaccaaca
actggggggtcagcagctagatgctgctgccgagactgctgtgtggagccacgcccggaa
ttgccccctgcatttccccctcaactctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103752296
Entry
103752296         CDS       T03372                                 

Gene name
Camk4
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04020  Calcium signaling pathway
ngi04024  cAMP signaling pathway
ngi04211  Longevity regulating pathway
ngi04371  Apelin signaling pathway
ngi04380  Osteoclast differentiation
ngi04720  Long-term potentiation
ngi04722  Neurotrophin signaling pathway
ngi04725  Cholinergic synapse
ngi04921  Oxytocin signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi05031  Amphetamine addiction
ngi05034  Alcoholism
ngi05214  Glioma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103752296 (Camk4)
   04020 Calcium signaling pathway
    103752296 (Camk4)
   04024 cAMP signaling pathway
    103752296 (Camk4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103752296 (Camk4)
   04925 Aldosterone synthesis and secretion
    103752296 (Camk4)
  09156 Nervous system
   04725 Cholinergic synapse
    103752296 (Camk4)
   04720 Long-term potentiation
    103752296 (Camk4)
   04722 Neurotrophin signaling pathway
    103752296 (Camk4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103752296 (Camk4)
  09149 Aging
   04211 Longevity regulating pathway
    103752296 (Camk4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    103752296 (Camk4)
  09165 Substance dependence
   05031 Amphetamine addiction
    103752296 (Camk4)
   05034 Alcoholism
    103752296 (Camk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103752296 (Camk4)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103752296 (Camk4)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   103752296 (Camk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr CENP-N
Other DBs
NCBI-GeneID: 103752296
NCBI-ProteinID: XP_008854241
LinkDB
Position
Un
AA seq 225 aa
MKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNC
EYYFISPWWDEVSLNAKDLAAVKAVVASSRLGSASSSHSSIQESHKESREPSPTQDVKDN
KALSEKKMQEGAKVAAKGAGAELRKLDLGEMVKDAVVNAEEASRMVPQALEDRMKTAGPA
EPAIERGLGEEKMKTMEEAVVPKDEEETLAVGLGTPQEDVILPEY
NT seq 678 nt   +upstreamnt  +downstreamnt
atgaagacagtgtgtgggaccccagggtactgcgcgcctgaaattctcagaggctgtgcc
tatggacctgaggtggacatgtggtctgtaggaataatcacctacatcttactttgtgga
tttgaaccattctatgatgaaagaggtgatcagttcatgttcagaagaattctgaattgt
gaatattactttatctccccctggtgggatgaagtatctttaaatgccaaggacttggca
gcggtgaaggctgttgtggcctcttctcggttgggaagtgcaagcagcagccatagcagc
atccaggagagccacaaggagagccgagaaccatctccaacccaagatgtcaaggacaac
aaagctctttcagaaaagaaaatgcaagaaggggccaaagtggcagccaagggtgcaggg
gctgagctgaggaagctggatctcggggagatggtgaaagatgcagttgtaaatgctgag
gaggcctccaggatggtgccccaggcactggaggataggatgaagacagctggtccagct
gagccagcaatagagaggggattgggggaggagaaaatgaagactatggaggaagcagtg
gtccccaaagatgaggaggaaacccttgctgtgggacttgggactccacaggaagatgtg
atcctgccagagtactaa

DBGET integrated database retrieval system