KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727190
Entry
103727190         CDS       T03372                                 

Gene name
Fgf9
Definition
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103727190 (Fgf9)
   04014 Ras signaling pathway
    103727190 (Fgf9)
   04015 Rap1 signaling pathway
    103727190 (Fgf9)
   04020 Calcium signaling pathway
    103727190 (Fgf9)
   04151 PI3K-Akt signaling pathway
    103727190 (Fgf9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103727190 (Fgf9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103727190 (Fgf9)
  09162 Cancer: specific types
   05226 Gastric cancer
    103727190 (Fgf9)
   05218 Melanoma
    103727190 (Fgf9)
   05224 Breast cancer
    103727190 (Fgf9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103727190 (Fgf9)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103727190 (Fgf9)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103727190 (Fgf9)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103727190 (Fgf9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103727190
NCBI-ProteinID: XP_008823227
LinkDB
Position
Un
AA seq 208 aa
MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHMDTGRRFYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctccgttaggtgaagttgggagctatttcggtgtgcaggacgcggtaccgttcggg
aacgtgccggtgttgccggtggacagcccggtgttgctaagtgaccacctgggtcagtct
gaagcaggggggctgccccggggacccgcagtcacggacttggatcatttgaaggggatt
ctcaggcggaggcagctgtactgcaggactggatttcacttagaaatcttccctaatggt
accattcaggggaccaggaaagaccacagccgattcggcattctggaatttatcagtata
gcagtgggcctggtcagcattcgtggtgtggacagtggactctacctcggcatgaatgag
aaaggggagctgtatggatcagaaaaactaactcaagagtgtgtattcagagaacagttt
gaagaaaattggtataacacctactcatcgaacctgtataaacacatggacactggaagg
agattctatgttgcattaaataaagacgggaccccaagagaagggaccaggactaaacgg
caccagaaattcacacattttttacctagaccagtggaccctgacaaagtacctgaacta
tataaggatattctaagccaaagctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727544
Entry
103727544         CDS       T03372                                 

Gene name
Fgf6
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103727544 (Fgf6)
   04014 Ras signaling pathway
    103727544 (Fgf6)
   04015 Rap1 signaling pathway
    103727544 (Fgf6)
   04020 Calcium signaling pathway
    103727544 (Fgf6)
   04151 PI3K-Akt signaling pathway
    103727544 (Fgf6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103727544 (Fgf6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103727544 (Fgf6)
  09162 Cancer: specific types
   05226 Gastric cancer
    103727544 (Fgf6)
   05218 Melanoma
    103727544 (Fgf6)
   05224 Breast cancer
    103727544 (Fgf6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103727544 (Fgf6)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103727544 (Fgf6)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103727544 (Fgf6)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103727544 (Fgf6)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103727544
NCBI-ProteinID: XP_008823683
LinkDB
Position
Un
AA seq 208 aa
MALGQRLFITMSRGAGRLQGTLQGLVFLGVLVGMVVPSPAGARTNGTLLDSRSWGTLLSR
SRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGRISGTHEENPYSLLEI
STVERGVVSLFGVKSALFVAMNSKGRLYTMPSFQEECKFRETLLPNNYNAYESDLYRGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccctgggacagaggctgttcatcactatgtcccgtggagcaggacgccttcagggc
acgctgcagggtctcgtcttcctaggcgtcctagtgggcatggtggtgccctcgcctgca
ggcgcccgcaccaacggcacgctgctggactccagaagctggggcaccctcttgtccagg
tctcgcgctggactagctggagagatcgcgggagtgaattgggaaagtggttatttggtg
ggcatcaagcggcaacggagactctactgcaacgtgggcattggcttccacctccaggta
ctccccgacggccggatcagtggaacacacgaggagaacccctacagcctgctggaaatt
tccacagtggagcgaggggtggtgagcctctttggagtgaaaagcgcccttttcgttgcc
atgaacagtaaaggaagattatacacaatgcccagcttccaagaggaatgcaagttcaga
gaaactctcctgcccaacaattacaatgcctacgagtcagacctgtaccgagggacctat
atcgcactgagtaaatacggacgggtaaagcggggcagcaaggtgtccccaattatgact
gtgactcacttccttcccaggatataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727545
Entry
103727545         CDS       T03372                                 

Gene name
Fgf23
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103727545 (Fgf23)
   04014 Ras signaling pathway
    103727545 (Fgf23)
   04015 Rap1 signaling pathway
    103727545 (Fgf23)
   04020 Calcium signaling pathway
    103727545 (Fgf23)
   04151 PI3K-Akt signaling pathway
    103727545 (Fgf23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103727545 (Fgf23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103727545 (Fgf23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103727545 (Fgf23)
  09162 Cancer: specific types
   05226 Gastric cancer
    103727545 (Fgf23)
   05218 Melanoma
    103727545 (Fgf23)
   05224 Breast cancer
    103727545 (Fgf23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103727545 (Fgf23)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103727545 (Fgf23)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103727545 (Fgf23)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103727545 (Fgf23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103727545
NCBI-ProteinID: XP_008823685
LinkDB
Position
Un
AA seq 250 aa
MLGAYLRLLICALCSAWSVNTIVAYPDTSPLLSSSWGGLTHLYTATARNSYHLQIHRDGH
VDGTPHQTIYSALMIRSEDAGFVVITGVMSRRFLCMDFRGNIFGSHHFSPENCRFLQRTL
ENGYDVYLSPQHHFLVSLGRAKRAFLPGTNPPPFSQFLSRRNEIPLLHFHTPRPRRHTRS
AEDEPERDPLKVLKPRPRATPAPASCSQELPSAEDGGPAASDPLGVLRGRVNPHAGAGGA
HRCRPFPRFI
NT seq 753 nt   +upstreamnt  +downstreamnt
atgttgggggcctacctcagactcctgatctgtgcgctgtgcagtgcgtggagtgtgaac
accatcgttgcctaccctgacacctcaccactgctcagctccagctggggcggcctgact
cacctgtacactgccacagccagaaacagctaccacctgcagatccacagggatggccat
gtggatggcacaccccatcaaaccatctacagtgccttgatgatcaggtcagaggatgca
ggcttcgtggttataacaggtgtgatgagccggaggttcctctgcatggatttcagaggc
aacattttcggatcacatcacttcagccccgagaactgcaggttcctccagcggacgctg
gagaacggctacgacgtctacctgtccccgcagcaccacttcctagtgagcctgggccga
gccaagagggcgttcctgccaggtaccaacccgccgcccttctcgcagttcctgtcgcgc
agaaacgagatcccgctgctgcacttccacaccccgcggccgcggagacacacgcgcagc
gcggaggacgagcccgagcgcgacccactcaaagtgctcaagccgcggccccgcgccact
cccgcgcccgcatcctgctcgcaggagctgccgagcgccgaggacggcggcccagcggcc
agcgaccccctgggggtgctgcggggccgggtgaacccgcacgcgggagccgggggagcg
catcgctgccgtcccttccccaggttcatctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103733041
Entry
103733041         CDS       T03372                                 

Gene name
Fgf7
Definition
(RefSeq) fibroblast growth factor 7
  KO
K04358  fibroblast growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103733041 (Fgf7)
   04014 Ras signaling pathway
    103733041 (Fgf7)
   04015 Rap1 signaling pathway
    103733041 (Fgf7)
   04020 Calcium signaling pathway
    103733041 (Fgf7)
   04151 PI3K-Akt signaling pathway
    103733041 (Fgf7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103733041 (Fgf7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103733041 (Fgf7)
  09162 Cancer: specific types
   05226 Gastric cancer
    103733041 (Fgf7)
   05218 Melanoma
    103733041 (Fgf7)
   05224 Breast cancer
    103733041 (Fgf7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103733041 (Fgf7)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103733041 (Fgf7)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103733041 (Fgf7)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103733041 (Fgf7)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103733041
NCBI-ProteinID: XP_008830017
LinkDB
Position
Un
AA seq 194 aa
MHKWILTWILPTLLYRSYFHIICLVGTMSLACNDMSPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEYYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGVPVRGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcacaaatggatactgacatggatcctgccaactctgctctacagatcatacttccac
atcatctgtctagtgggcactatgtctttagcttgcaatgacatgagtccagagcaaatg
gctacaaatgtgaactgctccagccccgagaggcacacaagaagctatgattacatggaa
ggaggggatataagagtgagaagacttttctgtcgaacacagtggtatctgaggattgac
aaacgaggcaaagtgaaagggacccaagagatgaagaacaattacaatatcatggaaatc
aggacagtggcagttggaattgtggcaatcaaaggggtggaaagtgaatactatcttgca
atgaacaaagaaggaaaactctatgcgaagaaagaatgcaatgaagattgcaacttcaaa
gaattaattctggaaaaccattacaacacatatgcatctgctaaatggacacacagtgga
ggagaaatgtttgttgctttaaatcaaaaaggggttcctgtacgagggaaaaaaacgaag
aaagaacaaaaaacggcccactttcttcctatggcaataacctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734036
Entry
103734036         CDS       T03372                                 

Gene name
Fgf10
Definition
(RefSeq) fibroblast growth factor 10
  KO
K04358  fibroblast growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103734036 (Fgf10)
   04014 Ras signaling pathway
    103734036 (Fgf10)
   04015 Rap1 signaling pathway
    103734036 (Fgf10)
   04020 Calcium signaling pathway
    103734036 (Fgf10)
   04151 PI3K-Akt signaling pathway
    103734036 (Fgf10)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103734036 (Fgf10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103734036 (Fgf10)
  09162 Cancer: specific types
   05226 Gastric cancer
    103734036 (Fgf10)
   05218 Melanoma
    103734036 (Fgf10)
   05224 Breast cancer
    103734036 (Fgf10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103734036 (Fgf10)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103734036 (Fgf10)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103734036 (Fgf10)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103734036 (Fgf10)
SSDB
Motif
Pfam: FGF SR-25 Fascin DUF515 DUF4614
Other DBs
NCBI-GeneID: 103734036
NCBI-ProteinID: XP_008831155
LinkDB
Position
Un
AA seq 224 aa
MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQVPGQDVVSPEATNSSSASSSSS
SSSSSSSSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKE
NCPYSILEITSVEIGVVAVKAINSNYYLAMNKRGKLYGSKEFNNDCKLKERIEENGYNTY
ASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
NT seq 675 nt   +upstreamnt  +downstreamnt
atgtggaaatggatactgacacattgtgcctcagcctttccccacctgccgggctgctgc
tgctgctgcttcttgttactgttcttggtgtcttctgtccctgtcacctgccaagttcct
ggtcaggacgtggtgtcaccggaggccaccaactcttcttccgcctcctcttcctcctcc
tcctcttcctcctcgtcctcctcttcgtcctcctccttttcctctccttccagtgccggg
aggcatgtgcggagctacaatcacctccaaggagatgtccgctggagaaagctattctcc
tttaccaagtactttctcaagattgagaagaacggcaaggtcagcggtactaagaaggag
aactgtccatacagtatcctggagataacatcagtggaaattggagttgttgctgtcaaa
gccattaacagcaactattacttagccatgaacaagaggggaaaactctatggttcaaaa
gaatttaacaatgactgtaagctgaaggagaggatcgaggaaaatggatacaatacctat
gcatcctttaactggcagcacaatggcaggcaaatgtatgtggcactgaatggaaaagga
gctcccaggagaggacagaaaacacgaaggaaaaacacctcagctcatttcctcccaatg
gtggtccactcatag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736084
Entry
103736084         CDS       T03372                                 

Gene name
Fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04390  Hippo signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103736084 (Fgf1)
   04014 Ras signaling pathway
    103736084 (Fgf1)
   04015 Rap1 signaling pathway
    103736084 (Fgf1)
   04390 Hippo signaling pathway
    103736084 (Fgf1)
   04020 Calcium signaling pathway
    103736084 (Fgf1)
   04151 PI3K-Akt signaling pathway
    103736084 (Fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103736084 (Fgf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103736084 (Fgf1)
  09162 Cancer: specific types
   05226 Gastric cancer
    103736084 (Fgf1)
   05218 Melanoma
    103736084 (Fgf1)
   05224 Breast cancer
    103736084 (Fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103736084 (Fgf1)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103736084 (Fgf1)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103736084 (Fgf1)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103736084 (Fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103736084
NCBI-ProteinID: XP_008833749
LinkDB
Position
Un
AA seq 155 aa
MAEGEITTFAALTEKFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKGTESGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYVSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcacgaccttcgcagccctgaccgagaagtttaatctgcctcta
ggaaactacaagaagcctaaactgctctactgcagcaacgggggccactttctgaggatc
cttccagatggcactgtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctgagtgcggaaagcgtgggcgaggtgtatataaagggaactgagtctggccagtacttg
gccatggacacggatggacttttatatggctcacagacaccaaatgaagaatgcttgttc
ctggaaaggctggaggaaaaccattacaacacctacgtatccaagaagcatgctgagaag
aactggtttgtcggcctcaagaagaacggaagctgcaagcgcggtcctcggactcactac
ggccagaaagcaatcttgtttctccccctaccagtgtcttctgattag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737403
Entry
103737403         CDS       T03372                                 

Gene name
Fgf22
Definition
(RefSeq) fibroblast growth factor 22
  KO
K04358  fibroblast growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103737403 (Fgf22)
   04014 Ras signaling pathway
    103737403 (Fgf22)
   04015 Rap1 signaling pathway
    103737403 (Fgf22)
   04020 Calcium signaling pathway
    103737403 (Fgf22)
   04151 PI3K-Akt signaling pathway
    103737403 (Fgf22)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103737403 (Fgf22)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103737403 (Fgf22)
  09162 Cancer: specific types
   05226 Gastric cancer
    103737403 (Fgf22)
   05218 Melanoma
    103737403 (Fgf22)
   05224 Breast cancer
    103737403 (Fgf22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103737403 (Fgf22)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103737403 (Fgf22)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103737403 (Fgf22)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103737403 (Fgf22)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103737403
NCBI-ProteinID: XP_008835482
LinkDB
Position
Un
AA seq 268 aa
MPPSARVAHARSRHLPGFVVPFWTVAAKGRSSRKQRMNYNSQEAAGGPWSSAADPAQVGM
RLWLGLAWLLLLAPGAAGQSHLTGYPHLEGDVRWRRLFSSTHFFLRVDSSGRVQGTRWRH
GRDSIMEIRSVRVGTVVIKAVYSGFYVAMNRRGHLYGSRVYSVDCRFWERIEENGYNTYV
SRRWRHRGRPMFLALDGRGTPRRGHCTCKHNTKRQNRVGVTPTPVQSQQPEDAASLELGT
VMHLLRGSEAEKTDTALPTLKQEEGATS
NT seq 807 nt   +upstreamnt  +downstreamnt
atgccgccctctgcccgcgttgcgcacgcgcgctcgcgccacctgccgggatttgtagtc
cctttttggacggtggctgcgaagggtcgttccagcaggaagcaaaggatgaactacaac
tcccaggaggcagcgggtggaccctggtcctccgcggccgacccggcgcaggtggggatg
cggctgtggctgggcctggcctggctgctgctgctggcgccgggcgctgcggggcagtcg
cacctgaccgggtacccgcacctggagggcgacgtgcgctggcgccgcctcttttcttcc
acgcacttcttcctgcgcgtggactccagcggccgcgtgcaggggacgcgctggcggcac
ggccgggacagcatcatggagatccgctctgtccgagtgggcaccgtggtgatcaaagct
gtgtactctggcttctatgtggcaatgaaccgcaggggccacctctatgggtcgcgggtc
tactctgtggactgcaggttctgggaacgcattgaagagaatggctacaacacatacgtg
tcaaggcgctggcgacaccgtggtcgacctatgttcctggcgctggatggccgggggact
ccccgaagagggcattgcacatgcaaacacaacacaaaaagacaaaacagggtcggagtg
actccgacacctgtccagtctcaacagcctgaggacgcagcatctctggagttggggaca
gtcatgcatcttctgagaggatcagaggcagagaaaacagacactgcactgcccactctg
aagcaggaggaaggggccacaagctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737833
Entry
103737833         CDS       T03372                                 

Gene name
Fgf16
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  fibroblast growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103737833 (Fgf16)
   04014 Ras signaling pathway
    103737833 (Fgf16)
   04015 Rap1 signaling pathway
    103737833 (Fgf16)
   04020 Calcium signaling pathway
    103737833 (Fgf16)
   04151 PI3K-Akt signaling pathway
    103737833 (Fgf16)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103737833 (Fgf16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103737833 (Fgf16)
  09162 Cancer: specific types
   05226 Gastric cancer
    103737833 (Fgf16)
   05218 Melanoma
    103737833 (Fgf16)
   05224 Breast cancer
    103737833 (Fgf16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103737833 (Fgf16)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103737833 (Fgf16)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103737833 (Fgf16)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103737833 (Fgf16)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103737833
NCBI-ProteinID: XP_008835893
LinkDB
Position
Un
AA seq 207 aa
MAEVGAVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFRYR
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcggaggtgggggccgtcttcgcgtccttggactgggacctgcacggtttctcctcg
tctctggggaacgtgcccttagctgactccccgggtttcctgaacgagcgcctgggccag
atcgaggggaagctgcagcgcggttcgcccacagacttcgcccacctgaaggggatcctg
cggcgccgccagctctactgccgcaccggcttccacctggagatcttccccaacggcacg
gtgcacggcacccgccacgaccacagccgctttggaattctggagtttatcagcctggct
gtggggctgatcagcatccggggagtggactctggcctgtacctagggatgaatgaaaga
ggagagctgtatggatcaaagaaactcacacgtgaatgtgttttccgggaacagtttgaa
gaaaactggtacaacacctatgcttccaccttgtacaaacactcggactcggagagacag
tattatgtggctctgaataaagacggctcaccccgggagggatacaggactaaacgacac
cagaaattcactcactttttacccaggccagtagatccttctaagttgccctccatgtcc
agagacctgttccgctataggtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742625
Entry
103742625         CDS       T03372                                 

Gene name
Fgf5
Definition
(RefSeq) fibroblast growth factor 5
  KO
K04358  fibroblast growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103742625 (Fgf5)
   04014 Ras signaling pathway
    103742625 (Fgf5)
   04015 Rap1 signaling pathway
    103742625 (Fgf5)
   04020 Calcium signaling pathway
    103742625 (Fgf5)
   04151 PI3K-Akt signaling pathway
    103742625 (Fgf5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103742625 (Fgf5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103742625 (Fgf5)
  09162 Cancer: specific types
   05226 Gastric cancer
    103742625 (Fgf5)
   05218 Melanoma
    103742625 (Fgf5)
   05224 Breast cancer
    103742625 (Fgf5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103742625 (Fgf5)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103742625 (Fgf5)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103742625 (Fgf5)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103742625 (Fgf5)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103742625
NCBI-ProteinID: XP_008841921
LinkDB
Position
Un
AA seq 266 aa
MSLSFLFLLFFSHLILSAWAHGEKRLTPKGQLGPSATDRNQGDSSSSRGRSSTTSSASSS
PAASPGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSILE
IFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIYRTE
KTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPSP
VKPKVPLSPPRRSPSTVKYRLKFRFG
NT seq 801 nt   +upstreamnt  +downstreamnt
atgagcttgtccttcctcttcctcctcttcttcagccacctgatcctcagcgcttgggct
cacggggagaagcgtctcactcccaaagggcagctcggaccctccgccactgataggaac
cagggagactccagcagcagccggggcaggagtagcacgacgtcttctgcctcctcttct
cccgcggcttctcccggcagccaaggaagcggcttggagcagagcagtttccagtggagc
ccttcggggcgccggaccggcagcctctactgcagagtgggcataggcttccatctgcag
atctatccggatggcaaagtcaatggctcccacgaagccaatatgttaagtattttggaa
atatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaacaaattttta
gcgatgtcaaaaaaaggaaaactccatgcaagtgccaaatttactgatgactgcaagttc
agggagcgatttcaagaaaacagctataatacctatgcttctgcaatatacagaactgaa
aagacagggcgcgagtggtatgtggccctgaataaaagagggaaagcaaagcgaggctgc
agcccacgggttaaacctcagcatgtatctacccacttcctgccaagattcaagcagtcg
gagcaaccagaactttctttcacagtcactgtaccggaaaagaaaaagccacctagccct
gtgaaacccaaagttcccctgtctccacctcgcagaagtcccagcacagtgaagtacagg
ctgaagttccgctttggatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743281
Entry
103743281         CDS       T03372                                 

Gene name
Fgf20
Definition
(RefSeq) fibroblast growth factor 20
  KO
K04358  fibroblast growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103743281 (Fgf20)
   04014 Ras signaling pathway
    103743281 (Fgf20)
   04015 Rap1 signaling pathway
    103743281 (Fgf20)
   04020 Calcium signaling pathway
    103743281 (Fgf20)
   04151 PI3K-Akt signaling pathway
    103743281 (Fgf20)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103743281 (Fgf20)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743281 (Fgf20)
  09162 Cancer: specific types
   05226 Gastric cancer
    103743281 (Fgf20)
   05218 Melanoma
    103743281 (Fgf20)
   05224 Breast cancer
    103743281 (Fgf20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103743281 (Fgf20)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103743281 (Fgf20)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103743281 (Fgf20)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103743281 (Fgf20)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103743281
NCBI-ProteinID: XP_008842743
LinkDB
Position
Un
AA seq 211 aa
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRGAAELGARGRQGSAELAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRFFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLMYT
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctcccttagccgaggttgggggcttcctgggcggcctggagggtttgggccagcag
gtgggctcgcacttcctgctgcctcctgccggggagcggccgccgctgctgggcgagcgc
cggggagctgcggagctgggcgcccgcggccggcagggctcagcggagctggcgcacctg
cacggcatactgcgccgccggcagctctactgccgcaccggcttccacctgcagatcttg
cccgatggcagcgtgcagggcacccggcaggaccacagcctcttcggtatcctggaattc
atcagtgtggcagtaggactggtcagtatcagaggtgtggacagtggtctttaccttgga
atgaatgacaaaggagaactctatggatcagagaaattgacttctgaatgcatctttagg
gaacaatttgaagagaactggtataatacctactcatctaacatatataaacatggagac
actggtcgcaggttttttgtggcacttaacaaagatggaacaccacgagatggagccagg
tccaaaagacatcaaaaatttacccacttcttacctagaccagtggatccagaaagagtt
ccagaattgtacaaagacctactcatgtacacttga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743629
Entry
103743629         CDS       T03372                                 

Gene name
Fgf21
Definition
(RefSeq) fibroblast growth factor 21
  KO
K22429  fibroblast growth factor 21
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04714  Thermogenesis
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103743629 (Fgf21)
   04014 Ras signaling pathway
    103743629 (Fgf21)
   04015 Rap1 signaling pathway
    103743629 (Fgf21)
   04020 Calcium signaling pathway
    103743629 (Fgf21)
   04151 PI3K-Akt signaling pathway
    103743629 (Fgf21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103743629 (Fgf21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103743629 (Fgf21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743629 (Fgf21)
  09162 Cancer: specific types
   05226 Gastric cancer
    103743629 (Fgf21)
   05218 Melanoma
    103743629 (Fgf21)
   05224 Breast cancer
    103743629 (Fgf21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103743629 (Fgf21)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103743629 (Fgf21)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103743629 (Fgf21)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103743629 (Fgf21)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103743629
NCBI-ProteinID: XP_008843226
LinkDB
Position
Un
AA seq 209 aa
MNWTKGRVGPQGLCIPVMAVLLLEACQARPIPDSSPLLQFGGQVRQRHLYTDDHQNTEAH
LEIRADGTVVGATHRSPESLLELKALKPGVIQILGVKASRFLCQRPDGTLYGSPHFDPEA
CSFRELLLEDGYNVYQSEAHGLLLRLPPRDSTNQDPVSWAPVRFLPLPGLLQEPQEPPGF
LAPEPPDVDSSDPLSMVGPLHGHSPSYAS
NT seq 630 nt   +upstreamnt  +downstreamnt
atgaactggacaaagggcagagttggaccccagggactgtgtatccctgtgatggctgtc
cttctgctggaagcctgccaggcacgccccatccctgactccagccccctcctccagttt
gggggccaagtccgacagagacacctctacacagatgaccaccagaacactgaagcccac
ctggaaattagggcagatggcactgtggtgggtgccacacaccgtagcccggaaagtctc
ctggagctcaaagccttgaagccaggtgtcattcaaatcttgggagttaaagcttcaagg
ttcctttgtcagaggccagatggaaccctgtatggatcgcctcactttgatccagaggcc
tgcagcttccgagagctgctccttgaagatggatataatgtctaccagtctgaagcccat
ggcctcctgctgcgcctgccccctcgggactccacaaaccaggacccagtatcctgggca
cctgtgcgtttcctgccccttccaggcctgctccaagaaccccaggagccccctggattc
ctggcccctgaaccccctgacgtggactcctccgaccctctgagcatggtgggtcctctg
catggccacagccccagttatgcttcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744005
Entry
103744005         CDS       T03372                                 

Gene name
Fgf8
Definition
(RefSeq) fibroblast growth factor 8
  KO
K04358  fibroblast growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103744005 (Fgf8)
   04014 Ras signaling pathway
    103744005 (Fgf8)
   04015 Rap1 signaling pathway
    103744005 (Fgf8)
   04020 Calcium signaling pathway
    103744005 (Fgf8)
   04151 PI3K-Akt signaling pathway
    103744005 (Fgf8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103744005 (Fgf8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103744005 (Fgf8)
  09162 Cancer: specific types
   05226 Gastric cancer
    103744005 (Fgf8)
   05218 Melanoma
    103744005 (Fgf8)
   05224 Breast cancer
    103744005 (Fgf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103744005 (Fgf8)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103744005 (Fgf8)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103744005 (Fgf8)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103744005 (Fgf8)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103744005
NCBI-ProteinID: XP_008843825
LinkDB
Position
Un
AA seq 244 aa
MGSPRSALSCLLLHLLVLCLQAQEGPGGGPALGREPASLLRAGREPQGVSQQVTVQSSPN
FTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETD
TFGSRVRVRGAETGLYICMNKKGKLIAKNNGKGKDCVFTEIVLENNYTALQNAKYEGWYM
AFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWA
PEPR
NT seq 735 nt   +upstreamnt  +downstreamnt
atgggcagcccccgctccgcgctgagctgcctgctgttgcacttactggttctctgcctc
caagcccaggaaggcccgggcggggggcctgcgctgggcagggagcccgcttccctgctc
cgagctggccgggagccccagggtgtttcccaacaggtaactgttcagtcctcacctaat
tttacacagcatgtgagggagcagagcctggtgacggatcagctcagccggcgcctcatc
cggacctaccagctctacagccgcaccagcgggaagcacgtgcaggtcctggccaacaag
cgcatcaacgccatggcagaagacggagaccccttcgcaaagctcatcgtggagactgat
acctttgggagcagagttcgagttcgaggagcagagactggtctctatatctgcatgaat
aagaaagggaaactgattgccaagaacaacggcaaaggcaaggactgcgtgttcaccgag
atcgtgctggagaacaactacacggcgttgcagaacgccaagtacgagggctggtacatg
gcctttacccgcaagggtcggccccgcaagggctccaagacgcgccagcaccagcgcgag
gtgcacttcatgaagaggctgccccgcggccatcacaccaccgagcagagcctgcgcttc
gagttcctcaactacccgcccttcacgcgcagcctgcgcggcagccagaggacttgggcc
ccggagccccgatag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746947
Entry
103746947         CDS       T03372                                 

Gene name
Fgf2
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04810  Regulation of actin cytoskeleton
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103746947 (Fgf2)
   04014 Ras signaling pathway
    103746947 (Fgf2)
   04015 Rap1 signaling pathway
    103746947 (Fgf2)
   04020 Calcium signaling pathway
    103746947 (Fgf2)
   04151 PI3K-Akt signaling pathway
    103746947 (Fgf2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103746947 (Fgf2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103746947 (Fgf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746947 (Fgf2)
   05205 Proteoglycans in cancer
    103746947 (Fgf2)
  09162 Cancer: specific types
   05226 Gastric cancer
    103746947 (Fgf2)
   05218 Melanoma
    103746947 (Fgf2)
   05224 Breast cancer
    103746947 (Fgf2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103746947 (Fgf2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103746947 (Fgf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103746947 (Fgf2)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103746947 (Fgf2)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103746947 (Fgf2)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103746947 (Fgf2)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 103746947
NCBI-ProteinID: XP_008847450
LinkDB
Position
Un
AA seq 154 aa
MAAGGITTLPGQPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVK
LQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYS
SWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 465 nt   +upstreamnt  +downstreamnt
atggcggccggcggcatcaccacgctgccagggcagccagaggacggcggcgccgccttc
ccgcctggccacttcaaggaccccaagcggctctactgtaagaacggcggcttcttcctg
cgcatccaccccgatggccgcgtggatggagtccgcgagaagagcgaccctcatgtcaaa
ctgcagctccaagcagaagagagaggcgttgtgtctatcaagggagtgtgtgccaaccgc
taccttgctatgaaggaagatggacgactgctggcttctaaatgtgttacagaagagtgt
ttcttttttgaacgattggaatctaataactacaatacttaccggtcaaggaaatactct
agttggtatgtggcactgaaacgaactgggcagtataaacttggatccaaaacaggacct
gggcagaaggctatactgtttcttccaatgtctgctaagagctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747727
Entry
103747727         CDS       T03372                                 

Gene name
Fgf17
Definition
(RefSeq) fibroblast growth factor 17
  KO
K04358  fibroblast growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103747727 (Fgf17)
   04014 Ras signaling pathway
    103747727 (Fgf17)
   04015 Rap1 signaling pathway
    103747727 (Fgf17)
   04020 Calcium signaling pathway
    103747727 (Fgf17)
   04151 PI3K-Akt signaling pathway
    103747727 (Fgf17)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103747727 (Fgf17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747727 (Fgf17)
  09162 Cancer: specific types
   05226 Gastric cancer
    103747727 (Fgf17)
   05218 Melanoma
    103747727 (Fgf17)
   05224 Breast cancer
    103747727 (Fgf17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103747727 (Fgf17)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103747727 (Fgf17)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103747727 (Fgf17)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103747727 (Fgf17)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 103747727
NCBI-ProteinID: XP_008848488
LinkDB
Position
Un
AA seq 216 aa
MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSR
TSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKP
SGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQ
GQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQPQT
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggagccgcccgcctgctgcccaaccttactctgtgcttgcagctcttgattctctgc
tgtcaaacacagggggagaatcacccgtctcctaattttaaccagtacgtgagggaccag
ggtgccatgactgaccaactgagcaggcggcagatccgtgagtaccagctctacagccgg
accagtggcaagcacgtgcaggtcaccgggcgtcgcatctccgccaccgctgaggacggc
aacaaattcgccaagctcatagtggagacggatacgttcggcagccgggtccggatcaag
ggggcagagagcgagaagtatatctgtatgaacaagaggggcaagctcatcgggaagccc
agcgggaagagcaaagactgcgtgttcaccgagatcgtgctggagaacaactacacagcc
ttccagaatgctcggcacgagggctggttcatggctttcactcggcagggccggccccgc
caggcctcccgaagccgccagaaccagcgagaggcccacttcatcaagcgcctctaccag
ggccagctgccgttccccaaccatgctgaaaggcagaagcagtttgagttcgtgggctcg
gcccccacccgcaggaccaagcgcacccggaggccccagccccaaacgtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748184
Entry
103748184         CDS       T03372                                 

Gene name
Fgf18
Definition
(RefSeq) fibroblast growth factor 18
  KO
K04358  fibroblast growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103748184 (Fgf18)
   04014 Ras signaling pathway
    103748184 (Fgf18)
   04015 Rap1 signaling pathway
    103748184 (Fgf18)
   04020 Calcium signaling pathway
    103748184 (Fgf18)
   04151 PI3K-Akt signaling pathway
    103748184 (Fgf18)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103748184 (Fgf18)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103748184 (Fgf18)
  09162 Cancer: specific types
   05226 Gastric cancer
    103748184 (Fgf18)
   05218 Melanoma
    103748184 (Fgf18)
   05224 Breast cancer
    103748184 (Fgf18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103748184 (Fgf18)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103748184 (Fgf18)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103748184 (Fgf18)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103748184 (Fgf18)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103748184
NCBI-ProteinID: XP_008848979
LinkDB
Position
Un
AA seq 207 aa
MYSAPSACTCLCLHFLLLCSQVQVLAAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
GQAELQKPFKYTTVTKRSRRIRPTHPG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtattcagcgccctccgcctgcacttgcctgtgtttacactttctgctgctgtgctcc
caggtccaggtgttggcagccgaggagaacgtggacttccgcatccatgtggagaaccag
acacgggctcgcgatgatgtgagtcgtaagcagctgcgcttgtaccagctctacagcagg
accagcgggaagcacattcaagtcttgggtcgtaggatcagtgcccggggcgaggatggg
gacaagtatgcccagctcctagtggagacagacacctttgggagccaagtccggatcaag
ggcaaggagacagagttctacctgtgtatgaaccgaaaaggaaagcttgtggggaagcct
gatggtactagcaaggagtgtgtgttcatcgagaaggttctggaaaacaactacacagcc
ctgatgtcagccaaatactcaggctggtacgtgggcttcaccaagaaggggcggccacgg
aagggccccaagacccgggagaaccagcaggatgtgcatttcatgaagcgctaccctaag
gggcaggctgagctgcagaagcccttcaagtataccacagtaaccaagcgttcccggagg
atccgccccacacaccccggctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751500
Entry
103751500         CDS       T03372                                 

Gene name
Fgf4
Definition
(RefSeq) fibroblast growth factor 4
  KO
K04358  fibroblast growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103751500 (Fgf4)
   04014 Ras signaling pathway
    103751500 (Fgf4)
   04015 Rap1 signaling pathway
    103751500 (Fgf4)
   04020 Calcium signaling pathway
    103751500 (Fgf4)
   04151 PI3K-Akt signaling pathway
    103751500 (Fgf4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103751500 (Fgf4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103751500 (Fgf4)
  09162 Cancer: specific types
   05226 Gastric cancer
    103751500 (Fgf4)
   05218 Melanoma
    103751500 (Fgf4)
   05224 Breast cancer
    103751500 (Fgf4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103751500 (Fgf4)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103751500 (Fgf4)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103751500 (Fgf4)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103751500 (Fgf4)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103751500
NCBI-ProteinID: XP_008853189
LinkDB
Position
Un
AA seq 205 aa
MAGPGPAAGTLLPAVLLALLLPWAGRGSAAPAAPNGTLEAELERRWDSLVARSLARLPVA
AQPPEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTSDSLLELSPV
QRGVVSIFGVASRFFVAMSNRGKLYGVPFFTQECKFKEILLPNNYNAYESHQYPGLFIAL
SKTGKTKKGNRVSPTMKVTHFLPRL
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcgggaccgggacccgccgccgggacgctcctcccggcagtcctgttggccctgctg
ctaccctgggccggccgaggctccgccgcacccgccgcacccaatggcaccctggaggcc
gagctggagcgccgctgggacagcctggtggcgcgctcgctggcgcggctgccggtggcc
gcgcagcccccggaggctgcggtccagagcggcgccggggactacctgctgggcatcaag
aggctgcgacgactctactgcaacgtgggcatcggcttccacctccaggtgctgcccgac
ggccgcatcggaggcgtgcacgccgacaccagcgacagtctgctggagctctctccggtg
caacggggtgtagtgagcatcttcggagtggccagccggttcttcgtggccatgagcaac
aggggcaagctctacggcgtgcctttcttcacccaggagtgcaagttcaaagagattttg
cttcctaataactacaacgcctatgaatcccaccagtatcctggcttgttcattgccctc
agcaagactgggaagaccaagaaggggaaccgggtgtctcccaccatgaaggtcacccac
ttcctccccaggctgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751507
Entry
103751507         CDS       T03372                                 

Gene name
Fgf19
Definition
(RefSeq) fibroblast growth factor 19
  KO
K22603  fibroblast growth factor 19
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103751507 (Fgf19)
   04014 Ras signaling pathway
    103751507 (Fgf19)
   04015 Rap1 signaling pathway
    103751507 (Fgf19)
   04020 Calcium signaling pathway
    103751507 (Fgf19)
   04151 PI3K-Akt signaling pathway
    103751507 (Fgf19)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103751507 (Fgf19)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103751507 (Fgf19)
  09162 Cancer: specific types
   05226 Gastric cancer
    103751507 (Fgf19)
   05218 Melanoma
    103751507 (Fgf19)
   05224 Breast cancer
    103751507 (Fgf19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103751507 (Fgf19)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103751507 (Fgf19)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103751507 (Fgf19)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103751507 (Fgf19)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103751507
NCBI-ProteinID: XP_008853204
LinkDB
Position
Un
AA seq 221 aa
MWRARRGCAVARALVLATLWLAVSGRPLARRPRALSDQGPHLHYGWDQPIRLRHLYAAGP
YGVSNCFLRIRSDGAVDCEEGQSQRSLLEIRAVALETVAIKDVSSVRYLCMSEDGKIQGL
VRYSEEDCAFKEEINYSGYNVYRSSKHHLPVALSGAKPRQQFTNKSLLRPSYFLPMLPQT
SEETREQLESEMLSLPLETDSMDPFRMVDDVGLVKSPSFQK
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtggagagcgcggagaggatgcgcggtggcccgagcgctggtcctggccacgctgtgg
ctggccgtgtccgggcgtcccctggcccggcgaccccgggctctgtccgaccaagggcca
catctgcactacggctgggaccagcccatccgcctgcggcacctgtacgccgcgggtccc
tacggcgtctccaactgcttcctgcgcatccgtagcgacggggcggtggactgcgaggag
ggccagagccagcgaagtttactggagatacgggctgtagctctggagaccgtggccatc
aaggatgtcagcagcgtccggtacctctgcatgagcgaggacggcaagatacaagggttg
gttcgttactcagaggaagattgtgccttcaaggaggaaattaactactctggctacaac
gtgtacaggtcctcgaagcatcacctcccagtggccctgagcggggccaagcccaggcag
cagttcactaacaaaagcctccttcggccctcctacttcctccccatgctgccccagacc
tcggaggagaccagggagcagctggaatccgagatgctgtctctgcccctggagactgac
agcatggacccatttcggatggtggacgacgtggggctggtgaagagtcccagcttccag
aagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751508
Entry
103751508         CDS       T03372                                 

Gene name
Fgf3
Definition
(RefSeq) fibroblast growth factor 3
  KO
K04358  fibroblast growth factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05200  Pathways in cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103751508 (Fgf3)
   04014 Ras signaling pathway
    103751508 (Fgf3)
   04015 Rap1 signaling pathway
    103751508 (Fgf3)
   04020 Calcium signaling pathway
    103751508 (Fgf3)
   04151 PI3K-Akt signaling pathway
    103751508 (Fgf3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103751508 (Fgf3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103751508 (Fgf3)
  09162 Cancer: specific types
   05226 Gastric cancer
    103751508 (Fgf3)
   05218 Melanoma
    103751508 (Fgf3)
   05224 Breast cancer
    103751508 (Fgf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103751508 (Fgf3)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103751508 (Fgf3)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103751508 (Fgf3)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103751508 (Fgf3)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103751508
NCBI-ProteinID: XP_008853205
LinkDB
Position
Un
AA seq 326 aa
MALQLLPGTGHTSSAGPQHLRVCQWTRPSQRDGPGVSGGKKAVAAVCTAWHSSVRSQLRA
LHAPGAGLQPPPPGGRDAAMNLLWPPLLWPLLLGLLEPGRPTTGPGARLRRDAGGRGGVY
EHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGVVAIKGLFSGRY
LAMNKRGRLYASEHYNAECEFLERIHELGYNTYASRLYRTGPSGPGMQWQPGAQRPWYVS
VNGKGRPRRGFKTRRTQKSSLFLPRVLGHKDHEMVRLLQSSQPRAPRDSAQPQRRRKKQS
PEGHRTVAPASAPATLGTQLVTGGRA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcgctccagctgctgcccggcactgggcacacttcatcggctgggccccagcatctg
agagtctgccagtggacacgtccaagccagagggatggcccaggggtgtccgggggcaag
aaggcagtagcggcggtctgcaccgcctggcactcctccgtgcgctcccagctccgcgcc
ctccatgcgcccggcgctgggttgcagcctccgccgcccggagggcgcgatgcggcgatg
aacctgctctggccgccgctgctctggccgctgctgctcgggcttctggagcccggtcga
ccgacgactggtcccggggcgcgtctgcggcgcgatgccggcggtcgcggcggggtctac
gagcacctcggcggggcgccacggcgccgcaagctctactgcgctaccaagtaccacctc
cagctgcacccgagcggccgcgtaaacggcagcctggagaacagcgcctacagtatcctg
gagatcaccgcggtggaagtgggcgtagtggccattaagggtctcttctctggcaggtac
ctggccatgaacaagaggggacgactgtacgcttcggagcactacaacgcagagtgtgag
ttcctggagcgcatccacgagctgggttacaacacatacgcctcccgtctgtaccgcacg
gggcccagcggaccagggatgcagtggcaacccggtgcccagagaccttggtacgtgtct
gtcaacggcaagggtcggccacgccgaggcttcaagacccggcgcacacagaagtcctcg
ctcttcctgccacgagtgctgggccacaaggaccacgagatggtgcggctgctgcagagc
agccagccacgcgccccacgtgacagcgcccagccccagcggcgacgcaagaaacagagc
ccggaaggccaccgcacggtggcgcccgcgtccgctcctgccactctgggtacccagctg
gtgacaggtggacgggcttga

DBGET integrated database retrieval system