KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727209
Entry
103727209         CDS       T03372                                 

Gene name
Brca2
Definition
(RefSeq) BRCA2, DNA repair associated
  KO
K08775  breast cancer 2 susceptibility protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi03440  Homologous recombination
ngi03460  Fanconi anemia pathway
ngi05200  Pathways in cancer
ngi05212  Pancreatic cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    103727209 (Brca2)
   03460 Fanconi anemia pathway
    103727209 (Brca2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103727209 (Brca2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103727209 (Brca2)
   05224 Breast cancer
    103727209 (Brca2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103727209 (Brca2)
   03036 Chromosome and associated proteins [BR:ngi03036]
    103727209 (Brca2)
   03400 DNA repair and recombination proteins [BR:ngi03400]
    103727209 (Brca2)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    103727209 (Brca2)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103727209 (Brca2)
DNA repair and recombination proteins [BR:ngi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     103727209 (Brca2)
   FA (Fanconi anemia) pathway
    Downstream FA components
     103727209 (Brca2)
SSDB
Motif
Pfam: BRCA-2_helical BRCA2 BRCA-2_OB3 BRCA-2_OB1 Tower
Other DBs
NCBI-GeneID: 103727209
NCBI-ProteinID: XP_008823246
LinkDB
Position
Un
AA seq 3373 aa
MPIEYKRKPTFFEIFKERCRKADLGPISLNWFEELSSEAPLYNSESLEESEYKTNSYEPH
LFKTPQRKAFYHQLASTPIIFKEHGQTLPLYQSPLKELGKDIVHNECKNHHKMTVKRHHV
IDVTSPSLKSCLRESPLALRCTQVTPQRERPVMCGSLFCTPKLEKGQTPKHISESLGVEV
DSDMSWSSSLATPPTCSSTVLIVKNEEAPETEFPNDATAILKSCFSNYNESLRKNDGFIP
SVVDNENKNQREPISHGLGKMVRNSFGRINTDKDHLGVPNVNASALEDEVPELTADVPEE
VPFSLCLPKTRIRNLQKTKGKSRKKIFCETRTDELSEEPEKEVKENKHSFASEVELSDRD
PLDTDVADQKPFGTSREEISTEAESSSGCGWSQLTLSGLSGTRMPKITPLHVLPCNQNNS
EKDVIDTKKEPISFIPSENSLPCFSSLPKPEKVFHEEALVDECERQHLESQEDSVLGRKQ
AGSGTSQVASPIQGIRKSIFKTREPLEETFDTVFSDNVTNLNFKETEASESRLEIQAVCS
QTENSLCPISVDNESWPATISSVPVKNAGLISTLKNKRRKFIYAINDDISHEGKTIQKDK
KSELTNPLAQFEANAFEAPFTFINADSGLSNSFVKRNCFQNDTEEPPLSLISSFGDTFSK
ENSYNNTHISQDLNYKETTVSEEKLQPFTTLETDFLSCLRERPCEVDRKSHKVSDTKEGL
IAVCDPAGQHSAMEQSSIHFESQESPLGGHSNTSTLTVTCCSSKDPPLNPDVDCRGKASY
KISEELKYESSKVSIELNKNSPLGKNEMCILSENSKKTELLPPGKYITETTPSVKLQFNQ
NTELTVIRKDQEETTLISEITVNINSEELFPDNENNFVFQITNDRNSPALRNSKELHKED
LSYTEEPIPKNSSMVIDRDRDKKAAQVLMTEENLDSSTVLHGGMKERRKSGQHHLKVTPD
QDLKSYTTLDMKSDRNNDYAEKWSGLLDPVLNHNSGGGFRTASNKEIKLLEHNIKKSRML
FKDIEEQYPTSLSCIDIVNTLSLGNQEKVSKPASFDSQPVNTVSAHVESQVFVSCEDNLT
TPQLLSLKQDFNSHHNLTLSQKAEITELSTILEESGSQFEFTQFRKPSRIIQGNTCEMPG
NQVVALLASPEERKDVKLPLTIDSSSIGQIDNSKKIDAIGVKQNFPCLLKSNCDKSASCF
LTDSEVEFGGFYSALGTKLSVSSEALQKAVKLFSDIENSEETSAVQVDPGSSFSSEFCHS
VTSVFKIKNNSNKNFDKTSKCQVTLQNNIEMTTGIFVKNYTRNTKSEDKKYTCSQRNSCK
LEDYDSKSSISDRIYTDESDLACVDQYNKHLKPSSQFVRDGNIQIKESLSDLTCLEAVKA
EEACHVKFSNKEQLTAGKMEQNIKDTGISFQTVSGKNIRVSKESLNKIANFFDQETEELT
LFSDSLNSKFLSGINKNNMGISRHRETVSIKNKILEDCIPIGNASQLPTFQQLPECKIEK
IKEPTVLSFHTASGKKVKITQESLDKVKNLFDEKQHVSKVTSFSHQVAKIVKDREVCKEG
LALAYERIEITAPKCEEMHNSLDNNENFVSKDTGVLPKQTDNLNRQTKNLKTSNNIPFKS
QVHENIKKEIEKNPATCCINQIPCSAIEDSALAFYTGHGRKISVSQASLSKAKKWFKELD
DQLEERNAGKVVCLKEYPGDYVGNPSYENSLNSIKTENENNLASANQGPTYLSNCSMYNS
HPEHSTFCHSDDTCNESGYFSKNTVDPDIQPIMQNVEDKNNAFPPQRSTIKNVNTYLQTI
NEDVCVQKVETNSLPCTTKNVTIDLAIPDSNDCGVGSPAFSTASKIICISQEARKTVKER
FTDNCDKITKQNTESKSHTCQIRCHKALDNSQGSICPDSLSDKEHINSNKVFAATQNEQS
VSGVEKAPGISPRVSLKASDVCKFNIAELPQPDFPPRTCGIFSTASGKFVQVSNASLQKA
KHMFSEIEGSATQLSSTVAFKSSEQSDRFTRDENAVVHDFQNVQSFPETALWNVDSSVFS
GFSTASGKQVAISESALHKVKEMLEEFDSIGTEYIQHSLTSKQNVSKILPLPHVHKRSSE
YSVNSEMQKAYNNELKLPSCYNIESGSSENINSIKVSSNVSQFKQDTQLVLGTKVFLKNT
DLLGKEQTLPRNIEVEIGKTQTFSKVPLRTNVEDCSAYSEKPENCFETEAVEIAKAFMED
GELTDSEPPSCAHYSLLTCPNSKEILLNSRSRKRRIAVNPVGDPPIKRSLLNEFDKIIEN
KGEFLKPSKSTPDGTIKDRRLFMHHVSLEPVTCGPFCTRKERQEIQNPHFTAPGQEFLSK
SHLFEHSTLEKSSSNLPVSVQPTGKVPVTGNEKKRCPITTGKSTKVFVPPFKTKSHFHGD
EHCITKNVSLEGSKQKLKCIDEYSYADSENIINESKIHQFNKNGSNQEETIIVTKCEEER
SDLITSLQHARDLQDMRIKKKERQHIFPQPGSLYLAKTSTLPRISLKAAVRGQVPSACPH
KQLYMYGVSKQCIKINSKNAECFQFSIQDYFGKENLHAGKGIQLADGGWLIPSNDGKAGK
EEFYRALCDTPGVDPKLVSRVWVYNHYRWIIWKLAAMEFSFPKEFANRCLNPERVLLQLK
YRYDVEIDSSRRSAIKKIVERDDTPAKTLVLCVSDIISSSTSISETSGVDTKKVDVIELT
DGWYAVKAQLDPPLLALLKSGRLTVGQKIIVHGAELMGSSDACAPLEAPASLMLKISANS
TRPACWYTKLGFFPDPRPFPLPLSSLFSDGGNVGCVDIIVQRVYPMQWVEKTASGLYVFR
NEKEEEKEATKFAEVQQKKLEALFTKIQAEFKDPEENKTKQCMPSHALTRQQVHSLQDGA
DLYEAVKNAPDPDYLEGYFTEEQLRALNNHRQMLNDKKQAQIQLEFRKALESAEQEEQGL
SRDVTTVWKLRIESYKKNEKSAILSIWRPSSDLHSLLTEGKRYRIYHLATSKSKSKSERT
NIQLATTKKTQYQQLPASDEILFQVYQPRAPLHFSRLLEPAFQPPCSEVDLVGFVVSIVK
KIGLGPLVYLSDECLNLLAVKFWTDPNEDVIKPHMLITASNLQWRSESQSGIPTLFAGDF
SMFSGSPKEAHFQETVNRMKHAVENIDSFCNNAKRKLIHLLNANSPRWSTPTRDSKPELC
PAPILLATGNKLLRSSPNCERSHHSPLSQCTPKDKSVSVPVSPQMASKSCKGERELDYPR
NCRKRKALDFLSRLPLPPPVSPICTFVSPAAQKAFQPPRSCGTKYETPIKKKESSSPRMT
PLKKANQISLLERDSIADEELALLNTQALVSTSVGDNQCLSLSESTRTSSNSDHHMTPLL
RVQESSQASTEEG
NT seq 10122 nt   +upstreamnt  +downstreamnt
atgcctattgaatacaaaaggaaaccaactttttttgaaatttttaaggagcgatgccgc
aaagcagatctaggacccataagccttaattggtttgaagaactttcttcagaagctcca
ctctataattcggaatccctagaagaatctgaatataaaaccaacagttatgagccacac
ctatttaaaacaccacaaaggaaagccttttatcatcagttggcttcaactccaataata
ttcaaggaacatggtcaaactctgccactataccaatcacctttaaaggaattaggaaag
gatattgtacataatgaatgtaaaaatcaccataaaatgacagtaaaaagacaccatgta
attgatgttaccagtccatctctgaaatcttgtcttcgtgaaagtcctcttgctctacga
tgtacacaagtgacaccacagagagaaaggccagtgatgtgtggaagtttattttgtaca
ccaaaacttgagaagggtcagacaccaaaacatatttctgaaagtctgggagttgaggtg
gactctgatatgtcttggtcaagttcattagctacaccaccaacctgtagttctactgtg
ctcatagtcaaaaatgaggaagcacctgaaactgaatttcccaatgatgctactgctatt
ttgaaaagctgtttttctaactacaatgaaagtttgagaaagaacgatggatttattcct
tccgtggttgacaatgaaaataaaaaccaaagagaacctatcagtcatggattgggaaaa
atggtaaggaattcatttggcagaataaatactgacaaagaccaccttggagtgccaaat
gtcaatgccagtgccctagaagacgaagtacctgagctaactgcagatgttcctgaagaa
gttcctttttccttgtgcttacctaagactagaataagaaatctgcaaaaaacaaagggc
aagtccaggaagaaaattttctgtgagacaagaactgatgaattaagtgaagaacctgaa
aaagaagttaaagaaaataaacattcatttgcatctgaagtggaactgagtgatcgtgat
cccttagatacagatgtagcagaccagaagccctttggcacttcaagggaggaaatctcc
acagaagctgaatcatcttcaggctgtggatggtctcagctaaccctctcaggtctaagt
ggaactcggatgccgaaaataaccccccttcatgttttgccttgtaaccaaaataattcg
gaaaaagacgtcatagataccaagaaagaacctatcagctttattccttcagaaaattct
ttgccttgtttttccagtctgccaaaaccggaaaaggtcttccatgaggaagcactggta
gacgagtgtgaaaggcaacatctcgagtctcaggaagactctgttcttgggaggaagcaa
gcaggatctggaacttctcaagtggcctctcccattcagggcattagaaagtctatcttc
aagacgagagagccacttgaagagacttttgatactgttttctcagataatgtgaccaat
ctcaactttaaagagactgaagcctctgaaagtagattggaaattcaagctgtttgctca
cagacggagaattctttatgtcctatttcagttgataatgaaagctggccagccactatt
agttctgtacctgtgaaaaatgcaggattaatatctactttgaaaaataaaagaagaaag
tttatttatgctataaatgatgacatttctcatgaaggcaaaacaatacaaaaagacaaa
aaatcagagctaactaaccctctagcccaatttgaagcaaatgctttcgaagcaccattt
acatttataaatgctgattcaggtttatctaattcttttgtgaaaagaaactgcttccag
aatgatactgaagaaccacctttgtccttgatcagttcctttggggatactttcagtaaa
gaaaatagttacaataatacacacatatctcaggatcttaattacaaagaaacaactgtt
agtgaagaaaaactgcagccatttacaaccctggaaactgattttctgtcatgccttcgg
gaaagaccatgtgaagttgatcgaaaaagccacaaagtttcagatacaaaagaaggcttg
attgcagtatgtgatcctgcaggacagcattcagcaatggaacagagtagcattcacttt
gaatcacaggaaagccccttaggtggccacagtaatactagcactcttacagtaacttgt
tgtagctccaaggatcccccgttaaacccagatgtggattgtagaggaaaagcatcatac
aaaatatcagaggaactaaaatatgaaagtagtaaagttagtattgaattaaacaaaaat
agtcccttgggaaaaaacgaaatgtgtattttaagtgaaaattctaaaaaaactgagctt
ttgccccctggaaagtatataacagaaacaacaccttcagtgaagttgcagttcaaccag
aatacagagctaacagtaatccggaaggaccaggaagaaactactttgatttcagaaata
actgtcaatataaattctgaagaacttttcccagacaatgagaataattttgtctttcaa
ataactaatgataggaatagtcctgctttacgaaattctaaggaacttcataaagaagac
ctcagttatacagaagagcctattcccaagaactcttccatggtaatagatagagacaga
gataagaaagcagcccaagtgttgatgacagaagaaaacttagattcatcaactgtactc
catggtggtatgaaggagcgcagaaagagtggacagcaccacctgaaagtaactccagac
caagacttaaaatcgtacaccaccttggatatgaaatcagatagaaacaatgattacgca
gagaaatggtcaggactcttagatccagttttgaatcataattctggaggtggcttcaga
acagcttccaataaagaaataaaacttttagaacataacatcaagaaaagcaggatgtta
ttcaaagatattgaagaacagtaccctactagtttatcttgtattgatattgttaatact
ttatcattaggaaaccaggaaaaagtaagcaagcctgctagttttgattcacagccagtt
aatactgtgtctgcacatgtggagagtcaagtatttgtttcttgtgaagataatctcaca
acacctcaattgttatctttaaagcaagattttaactcgcatcacaatttaacactcagc
caaaaggcagaaattacagaactttctactattttagaagaatcaggaagtcagtttgaa
tttacacagttcagaaagccaagccgtataatacagggcaatacatgtgaaatgcctggg
aaccaggtggttgccttacttgcctctcctgaggaacggaaagatgtcaaacttcccctc
acaattgattcctcatctataggtcaaatagataacagcaaaaaaattgatgcaattgga
gttaaacaaaacttcccttgcttgttgaaaagcaactgtgacaaaagtgcatcttgtttt
ttaacagacagtgaagtggagtttgggggcttttattctgctcttggcacaaagctgagt
gtttctagtgaagctctacaaaaagctgtgaaactgttcagtgacattgaaaatagtgag
gagacctctgcagtacaagtagacccaggaagttccttttcaagtgaattctgccattca
gtcacttcagtgttcaagataaaaaacaacagcaataaaaattttgataaaactagcaaa
tgccaggtaacattacaaaataatattgaaatgactactggcatttttgttaaaaattac
acaagaaatacaaaaagtgaagataagaaatatacttgttctcagagaaatagttgtaaa
cttgaagactatgatagtaaatcaagtataagtgataggatttatacagatgaaagtgac
ttggcatgtgttgatcagtacaataagcatcttaagccatctagccaatttgtgagggat
ggaaacatacaaattaaagaaagtttgtcagatttaacatgtttggaagctgtgaaagct
gaagaagcatgccatgtgaaattttcaaataaagagcaattaactgcaggtaagatggaa
caaaacataaaagatactggtatctcctttcagactgtaagtgggaaaaatatcagagtc
tccaaggagtcattaaataaaattgcaaatttctttgatcaggaaacagaagaattgacc
ctcttttcagattccttgaattctaaatttctttcaggcatcaataagaacaatatgggc
atttcacgtcatagggaaacagtcagtattaaaaacaagatattggaagactgtatccct
attggaaatgccagtcaattgcccactttccagcagcttcctgaatgtaaaatagaaaag
atcaaagaacctactgtattgagttttcatacagctagtgggaaaaaagttaaaattaca
caggaatctttggacaaagtgaaaaatctttttgatgagaaacaacatgttagtaaagtt
accagttttagtcatcaagtggcaaaaattgtaaaggacagagaggtctgtaaagaaggt
cttgcattagcatatgagagaattgaaataactgccccaaagtgtgaagaaatgcacaat
tctctagataataatgagaactttgtttctaaggacactggagtgctacccaagcaaact
gataatttaaacaggcaaactaaaaatcttaaaacatcaaataatatcccttttaagtct
caagtacatgaaaatataaaaaaagaaatagaaaaaaatcctgcaacttgctgcataaat
cagatcccttgttcagccattgaagattcagctttggcgttttatacaggacatggtaga
aaaatttctgtaagtcaggcttcactgtccaaagcaaaaaaatggtttaaagaattggat
gatcaactagaagaaagaaatgctggtaaagttgtatgtttaaaggaatatcctggggat
tatgtaggaaatccttcatacgaaaatagtttgaacagtatcaaaactgaaaatgagaac
aatcttgcctctgcaaatcagggtcccacttatttaagtaactgcagcatgtataacagc
catccagaacattctactttttgtcattctgatgatacatgtaatgagtcagggtatttc
tccaaaaatacagttgatcctgatattcagccgattatgcagaatgttgaagacaaaaat
aatgctttccccccccaaagatctaccataaaaaatgtaaacacatacctgcaaactata
aatgaagatgtttgtgttcagaaagttgagactaactctttgccatgcacaactaaaaat
gtaaccattgacttggccatacctgattcaaatgattgtggggtagggtcacctgcattc
agtacagccagtaaaataatctgtatttcacaagaagccagaaaaacagtgaaagagaga
ttcacagacaactgtgataagataactaagcaaaatactgagagtaagtcacacacttgc
caaataaggtgtcataaagcattggataattcacagggttctatctgccctgactcttta
agtgacaaagaacatataaactcaaataaggtttttgctgctactcaaaatgagcaaagt
gtatctggagtggagaaagcgcctggaatatcacctcgtgttagtttgaaagcttcagat
gtgtgtaagtttaatatagcggaacttccccagccagattttcctccacgtacttgtggg
atttttagcacagcaagtggaaaatttgtacaagtatcaaatgcttcattgcaaaaggca
aaacacatgttttctgagatagagggcagtgctacgcagttatcttccacagtagcattt
aaaagcagtgaacagtcagaccgcttcacaagagatgaaaatgctgtggtacatgacttc
cagaatgtacagtccttcccagagactgctttatggaatgtagattcttctgttttctct
ggatttagtacagcaagtgggaaacaggttgcaatttcagaaagtgccttacacaaagtt
aaggaaatgttagaggaatttgattcaattggaactgaatatattcagcattcacttaca
tctaaacagaatgtatcaaaaatacttcctctccctcatgttcataagagatcttcagaa
tattctgtaaactctgaaatgcagaaggcctacaataacgaattaaaattaccaagttgc
tataatattgaaagtggttcttcagaaaatattaattctattaaagtttcttcaaatgtc
tctcagtttaagcaagacacacagttggttttaggaaccaaagtcttccttaaaaacact
gatcttttgggaaaagaacaaactttacccagaaacatagaggtggaaattggtaaaaca
caaactttttctaaggttcctctgagaacaaatgtcgaagactgttctgcttactctgaa
aaaccagaaaactgttttgaaacagaagcagtagagattgccaaagcttttatggaagat
ggtgagctgacagattctgaaccaccgagttgtgcccattactcattgttgacatgtcca
aacagcaaggaaattttgttaaattcaagaagtaggaaaagaagaattgctgttaaccca
gttggagaccctccaatcaaaagaagcttgttaaatgaatttgataagataatagaaaat
aaaggggaattcttaaagccttcaaaaagtactccagatggcacaataaaagatagaaga
ttgtttatgcatcatgtttcattagaaccagttacctgtggacctttttgcacaagaaaa
gaacggcaagaaatccagaatccacattttactgcacctggtcaagaatttttgtctaaa
tctcacctttttgagcactcgactttggaaaaatcttcaagcaatttaccagtttcagta
cagccgactggtaaagttcctgttacaggaaatgaaaagaagagatgccccattactaca
ggcaaatccaccaaagtctttgtcccgcctttcaaaaccaaatcacattttcatggagat
gaacattgcattaccaagaacgttagtttggaaggaagcaaacaaaaactcaagtgcata
gatgaatatagttatgctgatagtgaaaatattattaatgaaagcaagattcatcagttt
aacaaaaatggctccaatcaagaagaaactataattgtcacaaagtgtgaagaagaacgt
tcagatttaattacaagccttcaacatgccagagatctacaggatatgcgaattaaaaag
aaagaaaggcaacatatcttcccacagccaggcagtctatatcttgcgaaaacctccacc
ctgcctcgaatctctctgaaagctgcagtcaggggccaagttccttctgcatgccctcat
aagcagctctatatgtatggtgtttctaaacaatgcataaaaattaacagcaaaaatgct
gagtgttttcagttttctattcaggattattttggtaaggaaaatttacatgctggaaaa
ggaattcagttggctgatggaggatggttaataccctccaatgatggaaaggctggaaaa
gaagaattttatagggctctgtgtgacactccaggtgtggatccaaagcttgtttctaga
gtttgggtctataatcactacagatggattatatggaaactggcagctatggaattttct
tttcctaaggaatttgctaatagatgcctaaacccagaaagagtgctgcttcaactaaag
tacagatatgatgtggaaattgacagcagcagaagatcagctataaaaaaaatagtggaa
agggatgacacacctgcaaagacacttgttctctgtgtttctgacatcatttcatcaagc
acaagtatatctgaaacttctggtgttgataccaagaaagtagatgtgatcgaacttaca
gatggatggtatgctgtcaaggcccagctagatcctccactcctggccctcttaaagagt
gggagactgactgtgggtcagaagatcattgtgcacggggcagaactgatgggctcttct
gatgcctgtgcacctctagaagccccagcctctcttatgctaaagatttcagctaacagt
acccggcctgcttgctggtacaccaaacttgggttctttcctgatcccaggcccttccct
ctgcccttgtcctcgctcttcagtgacggaggaaacgttggctgtgttgatattattgtt
caaagagtgtaccctatgcagtgggtggagaaaacagcatctggattatatgtatttcgt
aatgaaaaagaagaggaaaaagaagcgacaaagtttgcagaggtccaacagaagaaacta
gaagctttattcactaaaattcaagcagaatttaaagaccctgaagaaaataaaacaaaa
cagtgtatgccatcccatgcactcacaaggcaacaagtccactctctccaggatggtgca
gatctttatgaagcagtgaaaaatgcaccagacccggattaccttgagggttatttcact
gaagagcagctaagagcattgaataatcacagacaaatgttgaatgataagaagcaggca
cagatccagttggaattcaggaaggccttggaatctgctgaacaagaggaacagggctta
tcaagggatgttacaactgtgtggaagttgcgtattgaaagctacaagaaaaatgaaaaa
tcagctatactgagtatctggcgtccatcatcagacttacactccctcctaacagaagga
aagagatatagaatctatcatcttgcaacatcaaaatctaaaagtaaatctgaaagaact
aacatacagttagcaaccacaaaaaaaactcagtatcagcaactaccggcttcagatgaa
atcttattccaggtttaccagccaagggcaccccttcatttcagcagactgttagaacca
gcctttcaaccaccttgttctgaagtagacctcgtaggatttgtagtttctattgtaaag
aaaataggtcttggtcctttggtctatttgtcagacgaatgccttaatttattagcagta
aagttctggacagatcctaatgaagatgttatcaaacctcatatgctaatcactgcaagc
aatctccagtggcgctcagaatcccagtcaggaattcctactttatttgctggagatttt
tccatgttttctggcagtccaaaggaagcccactttcaagagacagtcaacagaatgaag
catgctgttgagaatattgattcattttgcaacaatgcaaaaaggaagcttatacatctc
cttaatgcgaacagtcccaggtggtctacaccaactagagactccaagccagagctttgc
cctgctcccatactccttgctacaggaaataagttactgaggtcttctcctaactgtgag
cgcagtcatcacagtcctttatcacagtgtacaccaaaagacaagtctgtgtcggtacct
gtatcaccccaaatggcctcaaagtcttgtaaaggggagagagagcttgactacccaaga
aactgcagaaaaagaaaagcactggatttcctgagtcgactgcctttacctccccccgtc
agtcccatctgtacctttgtctctccagctgcacagaaggcatttcagccgccacggagt
tgtggcaccaaatatgaaacacctataaagaagaaagaatccagttctcctcggatgact
ccacttaaaaaagccaatcagatttctcttttggaacgtgattcaatagctgatgaggaa
cttgcattgctaaatacccaggcccttgtatctacttcggtgggagacaatcaatgtctg
tctctcagtgagtccacaaggacctcttccaattcagatcatcatatgacccctctgctc
agagtacaagagagctcccaagccagcacagaggaagggtag

DBGET integrated database retrieval system