KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727490Help
Entry
103727490         CDS       T03372                                 

Gene name
Lpcat3
Definition
(RefSeq) lysophosphatidylcholine acyltransferase 3
  KO
K13515  lysophospholipid acyltransferase 5 [EC:2.3.1.23 2.3.1.-]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00564  Glycerophospholipid metabolism
ngi04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103727490 (Lpcat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    103727490 (Lpcat3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ngi01004]
    103727490 (Lpcat3)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     103727490 (Lpcat3)
    2.3.1.-  
     103727490 (Lpcat3)
Lipid biosynthesis proteins [BR:ngi01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   103727490 (Lpcat3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBOAT
Motif
Other DBs
NCBI-GeneID: 103727490
NCBI-ProteinID: XP_017651658
LinkDB All DBs
Position
Un
AA seq 486 aa AA seqDB search
MASAAEGDVGAALEQMRGLRPGVELSLHNLATSLGASEQALRLIISIFLGYPLALFYRHY
LFYKDSYLIHLFHAFTGLSIAYFNFGPQFYHSLLCIVLQFLILRLMGRTATTIFTTFCFQ
MAYLLAGYYYTATGDYDIKWTMPHCVLTLKLIGLAIDYYDGGKDWNSLSSEQQTYAIRGV
PSLLEVAGFSYFYGAFLVGPQFSMNHYMKLVQGQLTDIPGKMPNSTIPALKRLSLGLIYL
VGYTLLSPHITEDYLLTEDYDNRPFWFRCMYMLVWGKFVLYKYVTCWLVTEGVCILSGLG
FSGFGEDGKAKWDACANMKVWLFETTPRFNGTIASFNINTNTWVARYIFKRLKFLGSKEL
SQGLSLLFLALWHGLHSGYLICFQMEFLIVIVEKQAASLIQESPALSSLASITALQPFYY
LVQQTIHWLFMGYSMTAFCLFTWDKWLKVYQSIYFLGHIFFLSLLVTLPYIHKAMVPRKE
KLKKKE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgcagctgagggggacgtgggagcggcactggagcagatgcgggggctgcgg
ccgggtgtcgagctgagccttcacaacttggcgacgtccctgggcgcgtcggaacaggcg
ctgcggctcatcatctccatcttcctgggttaccccttggctttgttttatcggcattac
cttttctacaaggacagctacctcatccatctcttccatgcttttacaggcctctccatt
gcttattttaactttggaccccagttctaccactccctgctgtgcattgtgcttcagttc
ctcatcctgcgactcatgggccgcaccgccaccaccattttcactaccttttgcttccag
atggcctaccttcttgctggatattattacacagccactggtgactacgatatcaagtgg
acaatgccacattgtgtcctgacgctgaagctaattggtttggctattgactactatgat
ggagggaaagactggaattccttgtcctctgagcaacagacatatgccatacggggtgtc
ccttccctgctggaagttgctggcttctcctacttctatggagccttcttggtagggccc
cagttctcaatgaaccactacatgaagctggtgcagggacagctgactgacataccaggg
aagatgccaaacagcaccatacctgctctcaagcgcctgagtctgggtctcatctaccta
gtgggctacaccctcctgagcccacacatcacagaagactatctccttactgaagactat
gataaccgccctttctggttccgctgcatgtacatgctggtctggggcaaatttgtgctg
tacaaatacgtcacctgttggctggtcacagaaggagtatgcattttgtcggggctgggc
ttcagtggcttcggagaagatgggaaagcgaagtgggatgcctgtgccaacatgaaggtg
tggctctttgaaacaactcctcgcttcaatggcaccattgcttctttcaacatcaacacc
aacacctgggtggcccgttacatcttcaaacgcctcaagttccttggaagtaaagaatta
tcacagggtctctccttgctgttcttggccctctggcatggcctacactcaggatacctg
atttgcttccagatggaattcctaattgttattgtggaaaagcaggctgccagcctaatt
caagagagcccagccctgagcagcctagcctccatcactgccctacagcccttctactac
ttggtgcaacagaccatccactggcttttcatgggttactccatgactgccttctgcctc
ttcacatgggacaaatggcttaaggtctatcaatccatctactttcttggacacatcttc
ttcttgagcctactagtcacattgccttatattcacaaagcaatggtgccaaggaaagag
aagttaaaaaagaaggaataa

DBGET integrated database retrieval system