KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727530
Entry
103727530         CDS       T03372                                 

Gene name
Tnfrsf1a
Definition
(RefSeq) TNF receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04064  NF-kappa B signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04150  mTOR signaling pathway
ngi04210  Apoptosis
ngi04215  Apoptosis - multiple species
ngi04217  Necroptosis
ngi04380  Osteoclast differentiation
ngi04668  TNF signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi05010  Alzheimer disease
ngi05014  Amyotrophic lateral sclerosis
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05132  Salmonella infection
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103727530 (Tnfrsf1a)
   04064 NF-kappa B signaling pathway
    103727530 (Tnfrsf1a)
   04668 TNF signaling pathway
    103727530 (Tnfrsf1a)
   04071 Sphingolipid signaling pathway
    103727530 (Tnfrsf1a)
   04150 mTOR signaling pathway
    103727530 (Tnfrsf1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103727530 (Tnfrsf1a)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103727530 (Tnfrsf1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103727530 (Tnfrsf1a)
   04215 Apoptosis - multiple species
    103727530 (Tnfrsf1a)
   04217 Necroptosis
    103727530 (Tnfrsf1a)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103727530 (Tnfrsf1a)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103727530 (Tnfrsf1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103727530 (Tnfrsf1a)
   05014 Amyotrophic lateral sclerosis
    103727530 (Tnfrsf1a)
   05022 Pathways of neurodegeneration - multiple diseases
    103727530 (Tnfrsf1a)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103727530 (Tnfrsf1a)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103727530 (Tnfrsf1a)
   04931 Insulin resistance
    103727530 (Tnfrsf1a)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103727530 (Tnfrsf1a)
   05152 Tuberculosis
    103727530 (Tnfrsf1a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103727530 (Tnfrsf1a)
   05170 Human immunodeficiency virus 1 infection
    103727530 (Tnfrsf1a)
   05160 Hepatitis C
    103727530 (Tnfrsf1a)
   05171 Coronavirus disease - COVID-19
    103727530 (Tnfrsf1a)
   05164 Influenza A
    103727530 (Tnfrsf1a)
   05168 Herpes simplex virus 1 infection
    103727530 (Tnfrsf1a)
   05163 Human cytomegalovirus infection
    103727530 (Tnfrsf1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103727530 (Tnfrsf1a)
   05165 Human papillomavirus infection
    103727530 (Tnfrsf1a)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103727530 (Tnfrsf1a)
   05142 Chagas disease
    103727530 (Tnfrsf1a)
Cytokine receptors [BR:ngi04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103727530 (Tnfrsf1a)
CD molecules [BR:ngi04090]
 Proteins
  103727530 (Tnfrsf1a)
SSDB
Motif
Pfam: TNFR_c6 Death Papilloma_E5A ABATE
Other DBs
NCBI-GeneID: 103727530
NCBI-ProteinID: XP_008823655
LinkDB
Position
Un
AA seq 450 aa
MGLPIVPGLLLPPVLLALLVVIYPSGVTGLVPSGGDREKRDSLCPPGKYTHPLNNSVCCT
KCHKGTYLYDDCPGPGQETVCKECGKGTFTASQNHLKFCLSCKSCRKEMFQVEISPCRVD
KDTVCGCRENQFQHYLSDNLFECMDCSLCLNGTVNIHCQEKQNTVCTCHAGFFLSNNKCI
SCDQCKENQECMKLCLLPLQNKGTPDSGTTVLLPLVIFLGLCLLSFIFISLMCRYRRWKS
KLYSIICGKAASVKEGDVEGIVTKPLTTAPAPAFSPTPAFSPTPAFSPISSTHLTSSPTF
NPSDWPNFRVVSPLRDLSPTQCADPILYPSLASMPAPAAVQQWEDSSHPRRPDAADPVTL
YTVVDHVPPSRWKEFMRRLGLNEHEIERLELQNIRCLREAHYSMLEAWRRRTPRHEATLD
LLGRVLCDMDLFGCLDEIQEALGSPAPHLA
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgggtctccccatcgtgcctggcctgctgctgccaccggtgctcctggctctgttagtg
gtgatatacccctcaggggtcactggactggttccttccggtggggatcgggagaagagg
gatagtttatgtccacccggaaaatacacccatcctctgaataattccgtctgctgtact
aagtgccacaaaggaacctacttgtatgatgattgtccaggcccaggccaggaaacggtc
tgcaaagaatgtggaaaaggcacctttaccgcttcccagaaccacctcaaattttgcctc
agttgcaagtcatgtcggaaagaaatgttccaggtggagatttctccttgcagagtggac
aaggataccgtgtgtggctgtagggagaatcagttccagcactacttgagtgataatctt
ttcgagtgcatggactgcagcctctgcctcaatggcaccgtgaatatccactgtcaggag
aaacagaacaccgtgtgtacctgccatgcagggttctttctaagcaacaacaagtgcatc
tcttgtgatcagtgtaaggaaaaccaggagtgtatgaagttgtgcctgcttccacttcaa
aataaaggcactccagactcaggtaccacagtgctgttgcccctggtgatcttccttggt
ctttgccttttatctttcatcttcatcagtttaatgtgccgatatcgccggtggaaatcc
aagctctactccatcatttgtgggaaagcagcatctgtgaaagagggggatgttgaagga
attgttactaagcctctaaccacagcccctgccccagctttcagccccaccccagccttt
agccccaccccagccttcagtcccatctctagtacccacctcacttccagccccaccttc
aaccccagtgactggcccaacttcagggttgtgtcacctctcagggacctgtccccaacc
caatgtgctgaccctatcctctacccatccctggcctccatgccagcccctgcagctgtt
cagcagtgggaagacagctcccatcctcggcgtcctgatgctgcagaccccgtcacgctg
tacacggtggtggaccacgtgcccccatctcgctggaaggagttcatgcggcgcctagga
ttgaacgagcacgagatcgagcggctggaactgcagaacattcgctgcctgcgcgaggcg
cactacagtatgctggaggcctggcggcggcggacgccacgacacgaggccacgctggac
ctgttgggccgagtgctctgcgacatggacctgttcggctgcctggatgaaatccaggag
gcgctgggaagccccgcgccccacctcgcgtga

DBGET integrated database retrieval system