KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727841
Entry
103727841         CDS       T03372                                 

Gene name
Pias2
Definition
(RefSeq) protein inhibitor of activated STAT 2
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04120  Ubiquitin mediated proteolysis
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103727841 (Pias2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103727841 (Pias2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103727841 (Pias2)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     103727841 (Pias2)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   103727841 (Pias2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 103727841
NCBI-ProteinID: XP_008824124
LinkDB
Position
Un
AA seq 612 aa
MVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTL
EGLSDLSTIKSSVFNLDGSSSPVEPDLAVPGIHSLPSTSITPHSPSSPVGSVLLQDTKPT
FEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVR
EICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPK
NGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLK
MKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFD
AALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGTWCPMRP
KKDTMKVSSQPCTKIESSSVFSKPCSVTVANEASKKKVDVIDLTLESSSDEEEDPPAKRK
CIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDSAAIPPSLTDYSVPFHHTPVSSMSSDLP
GLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSETGVITS
SGSNIPDIISLD
NT seq 1839 nt   +upstreamnt  +downstreamnt
atggtttctagttttagggtttctgaattacaagtgttactaggctttgctggacggaat
aaaagtgggcgcaagcatgacctcctgatgagggcactgcatttattgaagagtggctgc
agccctgcggttcagattaaaattcgagaattgtatagacgccgatatccacggacactt
gaaggactttctgatttatccacaatcaaatcatcagttttcaatttggatggtagttca
tcacctgtagaacctgacttggctgtgcctggaatccattcgttgccttccacttcaatt
acacctcattcaccatcatctcctgttggttctgtgttgcttcaagatactaagcccaca
tttgagatgcagcaaccatctcctccaattcctccggtccatcctgatgtgcagttaaaa
aacctgcccttttatgatgttcttgatgttctcatcaagcccacaagtttagttcaaagc
agtattcagcggtttcaagagaaattttttatttttgctttgacacctcagcaagttaga
gagatatgcatatcaagagattttttgccaggtggtaggagagattatacagtccaagtt
cagctgcgactttgcctggcagagacaagttgccctcaagaagataactatcccaatagt
ctatgtataaaagtaaatggaaaactctttcctttgcctggctatgcaccaccgcctaaa
aatgggattgaacagaagcgccctggacgccccttgaatattacatctttagttcgattg
tcttcagctgtgccaaatcagatttccatttcttgggcatctgaaattggaaagaattat
tccatgtctgtatatcttgtgcgacagctcacttcagccatgttattacagagattaaaa
atgaaaggtattagaaatcctgatcattccagagcgctgattaaagaaaaacttacagca
gatcctgatagtgaaattgctacaactagtcttcgggtatcattgatgtgtcctttagga
aaaatgaggctgacaatcccatgccgtgctgtgacttgtacacatctacagtgttttgat
gctgccctttatcttcaaatgaatgagaagaagcccacctggatttgtcctgtttgtgac
aaaaaagctgcctatgaaagtctgatattagatgggcttttcatggaaattctcaatgac
tgttctgatgttgatgagatcaaattccaagaagatggtacttggtgcccaatgcgacct
aagaaggacactatgaaagtatccagccaaccctgcacaaaaatagaaagctcaagtgtc
ttcagtaaaccttgttcagtgactgtagctaatgaagcaagcaagaagaaagtagatgtt
attgatctaacactagaaagctcttctgatgaagaggaagaccctcctgccaaaaggaaa
tgcatctttatgtcagaaacacaaagcagtccaaccaaaggggttctcatgtatcagcca
tcctctgtaagggtacccagtgtgacttcggttgactccgctgctattccaccttcatta
acagactactcagtaccattccaccacacaccagtatcaagcatgtcatcagatttgcca
ggtttggattttctttcccttattccagttgatccccagtactgtcctcctatgtttttg
gatagtctcacctcacccttaacagcaagcagtacgtctgtcaccaccaccagcccccat
gaaagcagtactcatgttagttcatccagcagcaggagtgagacaggggtcataaccagc
agtggaagtaacattcctgatatcatctcattggactaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103729508
Entry
103729508         CDS       T03372                                 

Gene name
Pias3
Definition
(RefSeq) protein inhibitor of activated STAT 3
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04120  Ubiquitin mediated proteolysis
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103729508 (Pias3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103729508 (Pias3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103729508 (Pias3)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     103729508 (Pias3)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   103729508 (Pias3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 103729508
NCBI-ProteinID: XP_008825808
LinkDB
Position
Un
AA seq 629 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTMGPTDLSLLSLPPGTSPVGSPGPLAPIPSALLTPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNPSENKKKVEVIDLTIESSSDEEDLPPTKKHCPVTSAVIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGSDFLSSLPLPEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDTLGHFFQYRGTPSHFLGPLAPTLGSSHRSSSTPAPPPGRVNSIVAP
GSALREGHGGPLPSGPSLTGCRSDVISLD
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgagttaaagcacatggtgatgagtttccgggtgtctgagctccag
gtgcttcttggctttgctggccggaacaagagtggtcggaagcacgagctcctggccaag
gccctgcaccttctcaagtcgagctgtgcccccagtgtccagatgaagatcaaagaactt
taccgccggcgctttcctcggaagaccatggggcccactgatctttctctgctctctttg
ccccctggcacctctcctgtaggctcccctggccctctagctcccattccctcagccctc
ttgacccctggcaccttgctgggtcccaagcgagaggtagacatgcaccctcctctgcct
cagcctgtgcaccccgatgtcaccatgaaaccattgcccttctatgaagtctacggggag
ctcatccggcccactacccttgcatctacttctagccagaggtttgaagaagcacacttt
acctttgccctcactccccaacaggtgcagcagattctcacatccagagaggttctgcca
ggagccaagtgtgattataccatacaggtgcagctaaggttctgtctctgtgagactagc
tgtccccaagaggattatttcccccccaacctctttgtcaaggtcaatgggaagctgtgt
cccctgccgggttaccttcctcccaccaagaatggggctgaacccaagagacccagccgt
cccatcaacatcacacccctggctcgactctcagccactgttcccaacacaattgtggtc
aattggtcatctgaatttggacggaactactccttgtctgtgtacctggtgaggcagttg
actgcaggaacccttctacagaaactcagagcaaagggtatccggaatccagaccattcc
cgagcactgatcaaggagaaactaactgctgaccctgacagtgaggtggctactacaagt
ctacgggtgtcactcatgtgcccgctagggaagatgcgcctgactgtcccatgtcgagcc
ctcacctgtgcccacctgcagagcttcgatgctgctctttatctacagatgaacgaaaag
aagccaacatggacatgtcctgtgtgtgacaagaaggctccttatgaatctcttattatt
gatggcttattcatggaaattcttaattcctgttcggattgtgatgagatccagttcatg
gaagatggatcctggtgtccaatgaaacccaagaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtatagcccagtccaagagggcaatccatcagag
aataagaagaaagttgaagttattgacttgacaattgaaagctcatcagatgaggaagat
ctgcccccaaccaagaagcactgccctgttacctcagctgtcatcccagccctacctgga
agcaaaggagtcctgacatctggccaccagccatcttcggttcttcggagccctgcgatg
ggcacactgggcagtgatttcctgtccagtctcccactacctgagtacccaccggccttc
cccctgggggctgacatccaaggtttagatttattttctttccttcagactgagagtcag
cactatggtccttctgtcatcacttcgctagatgaacaggatacccttggccacttcttc
cagtaccgtgggaccccctcccacttcctgggcccactggcccccacgttggggagctct
caccgaagcagctccactccagcaccccctcctggccgtgtcaacagcattgtggctcct
gggagtgccttgagggaggggcatggaggacccctgccttcaggtccctctttgactggc
tgtcggtcagatgtcatttccttagactga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736908
Entry
103736908         CDS       T03372                                 

Gene name
Pias1
Definition
(RefSeq) protein inhibitor of activated STAT 1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04120  Ubiquitin mediated proteolysis
ngi04630  JAK-STAT signaling pathway
ngi05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103736908 (Pias1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103736908 (Pias1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    103736908 (Pias1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103736908 (Pias1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ngi04812]
    103736908 (Pias1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     103736908 (Pias1)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   103736908 (Pias1)
Cytoskeleton proteins [BR:ngi04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    103736908 (Pias1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 103736908
NCBI-ProteinID: XP_008834756
LinkDB
Position
Un
AA seq 662 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTENIKQISSDSKGWFTPKRMYQFFTRLTYSMAVYLVKQLS
STVLLQRLRAKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRAL
TCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKFCTDCDEIQFKE
DGSWAPMRSKKEVQEVSASYNGVDGCLSSTLEHQVASHNQSSNKNKKVEVIDLTIDSSSD
EEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRH
PFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMF
LDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHGVASRSSADTASIFGIMPDIIS
LD
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtactgttgggctacgctgggaggaacaagcacggacgcaaacacgaacttctcacaaaa
gccctgcatttgctaaaggctggttgtagccctgctgtacaaatgaaaattaaagaactc
tacaggcggcggttcccccagaaaattatgacgcctgcggacttgtctatccccaacgta
cattcaagtcctatgccagcaactttgtctccatccaccattccacagctcacttatgat
ggtcaccctgcatcttcaccattactccctgtttctcttctgggacctaaacatgaactg
gaactcccacatcttacatcagctcttcatccagtccatccggatataaaacttcaaaag
ctaccattttatgacttactggatgaactgataaaacctaccagtctagcatcagacaac
agtcagcgctttcgagaaacctgctttgcatttgccttgacacctcaacaagtgcagcag
atcagtagttccatggatatttctgggaccaagtgtgacttcacagtgcaggtccaatta
aggttttgtttatcggaaaccagttgtccacaagaagaccacttcccacccaatctgtgt
gtgaaagtgaatacaaaaccttgcagccttccaggctacctgccacctactaaaaatggt
gtggaaccaaagcgacccagccgaccaattaatatcacttcactcgtccgattatctacg
acagaaaacattaagcaaataagtagtgatagtaagggttggtttacccccaaaagaatg
taccagttctttactagattgacctattccatggcagtatatcttgtaaaacagttgtcc
tcaacagttcttcttcagaggttacgagcaaagggaataaggaatccggatcattctaga
gctttaattaaagagaaattaactgcagacccagacagtgaaatagctacgaccagccta
cgggtttctctcctgtgtccacttggtaaaatgcggctgacaattccatgtcgagccctt
acgtgttctcacctgcagtgttttgatgcaactctttatattcaaatgaatgagaaaaaa
ccaacctgggtttgtcctgtctgtgataagaaggctccatatgaacaccttattattgat
gggttgtttatggaaatcctaaagttctgtacagattgtgatgaaatacagtttaaagag
gatggttcgtgggcaccaatgagatcaaaaaaagaggtgcaggaagtctctgcctcatac
aatggagttgatggatgcttgagctccactttggagcatcaggtggcttcacacaaccag
tcctcaaataaaaacaagaaagtagaggtgattgacctcaccatagacagttcatctgat
gaagaggaagaagaaccctctgccaagaggacttgcccttccctgtctcctacatcacca
ctaaacaataaaggcattttgagtcttcctcatcaagcatctcctgtgtcccgcaccccc
agccttcctgctgtagatacaagctacattaacacctccctcatccaagactacaggcac
cctttccacatgacacccatgccttatgacttgcaaggattagatttctttcctttctta
tcaggagacaatcagcattacaacacctcgctgctcgctgcagcagcagcagcagtgtcg
gatgatcaagacctcctgcactcgtcccggtttttcccatatacctcctcacagatgttt
ctcgatcagttaagtgcaggaggaagcacttctctgccaaccaccaatggaagcagtagt
ggcagcaacagcagccttgtgtcttccaacagcctgagggaaagccatagccacggcgtg
gccagcaggagcagcgcagacacagcgtccatctttggcatcatgccagacattatatca
ttggactga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737273
Entry
103737273         CDS       T03372                                 

Gene name
Pias4
Definition
(RefSeq) protein inhibitor of activated STAT 4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04064  NF-kappa B signaling pathway
ngi04120  Ubiquitin mediated proteolysis
ngi04630  JAK-STAT signaling pathway
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103737273 (Pias4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103737273 (Pias4)
   04064 NF-kappa B signaling pathway
    103737273 (Pias4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103737273 (Pias4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ngi04121]
    103737273 (Pias4)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     103737273 (Pias4)
Ubiquitin system [BR:ngi04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   103737273 (Pias4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse DARPP-32 SAP Sporozoite_P67
Other DBs
NCBI-GeneID: 103737273
NCBI-ProteinID: XP_008835298
LinkDB
Position
Un
AA seq 507 aa
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKSAEPGPTPATRPLEPLALHSVPRTALSGPAVDYPALYGKYLNGLGRLPTKA
LKPEVRLVKLPFFNMLDELLKPTELVPQSTEKLQESPCIFALTPRQVELIRNSRELQPGV
KAVQVVLRICYSDTSSPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLT
HLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCKALVKEK
LRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWTCP
VCDKPAAYDQLIIDGLLSKILSECEDADEIEFLADGSWRSIRAEKEPSCSPQGPILVLGT
SDANGLLPAPSTNGGGSGVGMALGSTGSGAGTVGGLENGKPGADVVDLTLDSSSSSEDEE
DEDEDEEDEGPRPKRRCPFQKGLVPAC
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggcggcggagctggtggaggccaaaaacatggtgatgagtttccgagtatccgacctc
cagatgctgctaggcttcgtgggccgcagcaagagtggcctgaagcatgagctggttaca
cgggcactgcagctggtgcagttcgactgcagccctgagctcttcaagaagatcaaggaa
ctctatgagactcgctatgccaagaagagcgcagagccgggcccgacaccagccactcgg
ccgctcgagcccctggcactgcactcagtgcccaggactgccctgtcagggcctgccgtg
gactaccctgcactctacgggaagtatttaaatggactggggcgactgcccaccaaagcc
ctcaaacctgaggtgcgcctggtgaagctgccctttttcaacatgctggatgagttgttg
aagcccaccgagctggtcccacagagcactgagaagcttcaggaaagcccatgcatcttc
gcgctcacgccacggcaggtggaactgatccgaaactccagggagctgcagcccggagtg
aaggccgtacaggtggtgctgaggatctgttactctgacaccagcagcccacaagaagac
cagtacccacccaacatcgctgtgaaggtcaaccacagctactgctcagtgccgggttac
tacccttccaacaagcccggagtggagcccaagaggccgtgcagacccatcaacctcact
cacctcatgtacctgtcctcagccaccaaccgcatcactgtcacctggggcaactatggc
aagagctactcagtggcgctgtacctggtaaggcagctgacgtcgtcagagctgctacag
aggttgaagacaattggagtgaagcaccccgagctctgcaaggcactggtcaaagagaag
ctccgcctggacccagacagcgagatcgccaccactggggtgcgtgtgtccctcatctgc
ccgttggtgaagatgcggctctcagtgccctgccgtgcagagacctgcgcacacctgcag
tgcttcgacgctgtgttctacctgcagatgaatgagaaaaagcccacgtggacatgccct
gtgtgcgacaagcctgctgcctacgaccaactcatcattgacgggctgctatcaaagatc
ctgagcgagtgtgaagacgcagatgagatcgagttcctggccgatggctcgtggcgctca
atccgcgccgagaaggagccgagctgcagcccacagggccccatcctggtgctgggcacc
tcggatgccaacgggctcctgccagcccccagcaccaatggcggaggtagcggtgtaggc
atggccctgggcagcacgggcagtggggcgggcacggtaggtggcctggagaacgggaag
ccaggtgctgatgtggtggacctgacgctggacagctcgtcatcctcagaggatgaagag
gatgaggacgaggatgaggaggatgagggcccaaggcccaagcgtcgctgcccgtttcaa
aagggcttggtgccagcctgctga

DBGET integrated database retrieval system