KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727947
Entry
103727947         CDS       T03372                                 

Gene name
Hey1
Definition
(RefSeq) hes related family bHLH transcription factor with YRPW motif 1
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04330  Notch signaling pathway
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103727947 (Hey1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103727947 (Hey1)
  09162 Cancer: specific types
   05224 Breast cancer
    103727947 (Hey1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103727947 (Hey1)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    103727947 (Hey1)
SSDB
Motif
Pfam: HLH Hairy_orange dCache_2 HTH_Crp_2
Other DBs
NCBI-GeneID: 103727947
NCBI-ProteinID: XP_008824283
LinkDB
Position
Un
AA seq 299 aa
MKRAHPDYSSSDSELDETIEVEKESADENGNLTSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAM
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPW
GSAFGHHPHVAHPLLLPQNSHGNAGTTASPSEPHHQGRLASAHPEAPALRAPASGGVGPV
LPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPSTPTQAANLGKPYRPWGTEIGAF
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaagcgagctcacccagactacagctcctcggatagcgagctggacgagaccatcgag
gtggagaaggagagtgcggacgaaaatggaaacttgacttccgcgctgggttccatgtcc
ccaacgacatcttcccagattttggccagaaaaagacggagaggcatcatcgagaagcgc
cgacgagaccggattaataacagtttgtctgagctgaggaggctggtacccagtgctttt
gagaagcagggatctgctaaactagaaaaagccgagatcttgcagatgactgtggatcac
ctgaaaatgttgcacactgcaggagggaaaggctattttgacgcgcacgccctggctatg
gactatcgaagtttggggtttcgggaatgcctggccgaagttgctcgttacttgagcatc
atcgaaggactggatgcctcagacccccttcgcgttcgcctggtctcgcatctcaacaac
tacgcctcccagcgggaagcggcgagcggcgcgcacgcgggcctcggacacataccctgg
gggagcgccttcggacatcacccgcacgtcgcgcacccgctgctgctgccccagaatagc
cacgggaacgctggcaccacggcgtcgccctccgagccgcatcaccagggcaggctggcc
tcggcccatccggaggcgccggccttgcgagcgcccgctagcggcggcgtgggaccggtt
ctcccggtggtgacctcggcctccaaactgtcgccgcctctgctgtcctccgtggcctcg
ctgtctgccttccccttctccttcggctccttccatttactgagcccttcgacacccacg
caggcagccaaccttggaaagccctatagaccttgggggactgagatcggagctttctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736697
Entry
103736697         CDS       T03372                                 

Gene name
Heyl
Definition
(RefSeq) hes related family bHLH transcription factor with YRPW motif-like
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04330  Notch signaling pathway
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103736697 (Heyl)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103736697 (Heyl)
  09162 Cancer: specific types
   05224 Breast cancer
    103736697 (Heyl)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103736697 (Heyl)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    103736697 (Heyl)
SSDB
Motif
Pfam: HLH Hairy_orange
Other DBs
NCBI-GeneID: 103736697
NCBI-ProteinID: XP_008834427
LinkDB
Position
Un
AA seq 328 aa
MKRPRAPSGSDGESDGPIDVGREGELSQMARPLTTPSPSQMQARKKRRGIIEKRRRDRIN
SSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGAGFFDARALAVDFRSIG
FRECLTEVIRYLGVLEGPSSHADPVRIRLLSHLNSYAAEMEPLPTPTNALAFPVWPWSFL
HSCPGLPALSNQLAILGRVPGPVLHGASSPPYPLSALRSAPVHRATGTILPARRNLLPSR
DASSTQRARPPERPPAPSPTTRSSRAARSSHMVPILSSSSPRVPRAGKSADDVAGPISSP
SPMGPSGRPAGAVLCHSWVSEITEIGAF
NT seq 987 nt   +upstreamnt  +downstreamnt
atgaagcggcccagagcgcccagcggctccgacggcgagtcggacggacccatcgacgtg
ggccgcgagggtgagctgagccagatggccaggccactgaccacccccagcccttcacag
atgcaagccaggaagaagcgcagagggatcatagagaaacggcgcagagaccgaatcaac
agcagcctttctgaattacgacgcttggtccccactgcctttgagaaacagggctcttcc
aagctggagaaagctgaggtcttacagatgacagtggatcacttgaaaatgctccatgcc
actggtggtgcaggattctttgatgcccgagccctggcagttgacttccggagcattggt
tttcgggagtgcctcactgaggtcatcaggtacctgggggtcctggaaggacccagcagt
catgcagaccccgtacggattcgccttctgtcccatcttaacagctacgcagcagagatg
gagcctttacccacacccaccaatgctctggccttccctgtgtggccctggtccttcctc
catagctgtccagggctgccagccctgagcaaccagcttgccatcctgggaagagtgccc
ggccctgttcttcatggtgcctcctctcccccttaccccctctcagcccttcggtcagca
ccagtacacagagccactggaaccatcctgccagcccggaggaatttgttgcccagtcga
gacgcatcttccacccagagggcccgtcctcctgagaggccacctgccccttcacccacg
acccgcagcagcagagctgccaggagcagccacatggtccccatcctgtcgtcttcctcc
cccagggtccctagggctgggaaatcagctgacgatgtggccggccccatctccagtcca
tctcccatggggccatctgggaggcctgcaggggcagtactttgccactcctgggtctct
gaaatcactgaaattggggctttctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746526
Entry
103746526         CDS       T03372                                 

Gene name
Hey2
Definition
(RefSeq) hes related family bHLH transcription factor with YRPW motif 2
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04330  Notch signaling pathway
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103746526 (Hey2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746526 (Hey2)
  09162 Cancer: specific types
   05224 Breast cancer
    103746526 (Hey2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103746526 (Hey2)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    103746526 (Hey2)
SSDB
Motif
Pfam: HLH Hairy_orange dCache_2 HTH_Crp_2
Other DBs
NCBI-GeneID: 103746526
NCBI-ProteinID: XP_008846964
LinkDB
Position
Un
AA seq 337 aa
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSLMRSNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSTCASQREAAAMTSSMAHHHHPL
HPHHWAAAFHHLPAALLQSNGLHASESTPCRLSTSSEVPPAHGSALLTATFAHADSTLRM
PSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSAASSPQQTSSGTNSKPYRPWGTEVGAF
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaagcgtccgtgcgaggagacgacctcggaaagcgacatggacgagaccatcgacgtg
gggagcgagaacaattactctgggcaaagtacaagctctttgatgaggtcgaattctcca
acaaccacctctcaaattatggcaagaaaaaaaaggagagggatcatagagaaaagacgt
cgggatcggataaacaatagtttatctgagttgagacggctggtgccaacggcttttgaa
aaacaagggtctgcaaagttggaaaaagctgaaatcttgcaaatgacagtggaccatctg
aagatgcttcaggcaacagggggtaaaggctactttgatgcccatgctcttgccatggac
ttcatgagcattggattccgagagtgcttgacagaagtggccaggtacctgagttcagtg
gaaggcctggactcctcagatccgctgcgtgtgcgccttgtctctcatctcagcacctgt
gcctcccagcgggaggcagcagccatgacgtcctccatggcccaccaccaccaccccctg
catccacaccactgggcagcggccttccaccatctgcctgcagccctgctccaatccaat
ggactccatgcatcggagtcaaccccatgccgcctctccacatcttcagaagtgcctcct
gcccatggctctgccctgctcacggccacatttgcccatgcagattccacccttcggatg
ccatcaacaggcagcgtcgcgccttgtgtgccacctctctccacctctcttctgtctctc
tcggccactgtgcatgccgctgcagcagcagccaccgcagcagcacatagcttccctctg
tcctttgcgggggccttccccatgctaccccccaatgcagcagcagcagtggcagcagcc
acagcgatcagccctcccttgtcagtgtctgcagcttccagtcctcagcagaccagcagt
ggaacaaacagtaaaccttaccgaccctgggggacagaagtcggagccttttaa

DBGET integrated database retrieval system