KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103728037
Entry
103728037         CDS       T03372                                 

Gene name
Ppp3ca
Definition
(RefSeq) protein phosphatase 3 catalytic subunit alpha
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04114  Oocyte meiosis
ngi04218  Cellular senescence
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04380  Osteoclast differentiation
ngi04625  C-type lectin receptor signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04720  Long-term potentiation
ngi04724  Glutamatergic synapse
ngi04728  Dopaminergic synapse
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04924  Renin secretion
ngi05010  Alzheimer disease
ngi05014  Amyotrophic lateral sclerosis
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05031  Amphetamine addiction
ngi05152  Tuberculosis
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103728037 (Ppp3ca)
   04310 Wnt signaling pathway
    103728037 (Ppp3ca)
   04370 VEGF signaling pathway
    103728037 (Ppp3ca)
   04020 Calcium signaling pathway
    103728037 (Ppp3ca)
   04022 cGMP-PKG signaling pathway
    103728037 (Ppp3ca)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103728037 (Ppp3ca)
   04218 Cellular senescence
    103728037 (Ppp3ca)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103728037 (Ppp3ca)
   04650 Natural killer cell mediated cytotoxicity
    103728037 (Ppp3ca)
   04660 T cell receptor signaling pathway
    103728037 (Ppp3ca)
   04658 Th1 and Th2 cell differentiation
    103728037 (Ppp3ca)
   04659 Th17 cell differentiation
    103728037 (Ppp3ca)
   04662 B cell receptor signaling pathway
    103728037 (Ppp3ca)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103728037 (Ppp3ca)
   04921 Oxytocin signaling pathway
    103728037 (Ppp3ca)
   04924 Renin secretion
    103728037 (Ppp3ca)
  09156 Nervous system
   04724 Glutamatergic synapse
    103728037 (Ppp3ca)
   04728 Dopaminergic synapse
    103728037 (Ppp3ca)
   04720 Long-term potentiation
    103728037 (Ppp3ca)
  09158 Development and regeneration
   04360 Axon guidance
    103728037 (Ppp3ca)
   04380 Osteoclast differentiation
    103728037 (Ppp3ca)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103728037 (Ppp3ca)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103728037 (Ppp3ca)
   05014 Amyotrophic lateral sclerosis
    103728037 (Ppp3ca)
   05020 Prion disease
    103728037 (Ppp3ca)
   05022 Pathways of neurodegeneration - multiple diseases
    103728037 (Ppp3ca)
  09165 Substance dependence
   05031 Amphetamine addiction
    103728037 (Ppp3ca)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103728037 (Ppp3ca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103728037 (Ppp3ca)
   05170 Human immunodeficiency virus 1 infection
    103728037 (Ppp3ca)
   05163 Human cytomegalovirus infection
    103728037 (Ppp3ca)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103728037 (Ppp3ca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103728037 (Ppp3ca)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103728037 (Ppp3ca)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     103728037 (Ppp3ca)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 103728037
NCBI-ProteinID: XP_017651875
LinkDB
Position
Un
AA seq 521 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDALPSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gttccatttcctccaagtcaccgacttacagcaaaggaagtgtttgataatgatggaaaa
cctcgtgtggatatcttaaaagcacatctcatgaaggagggcaggctggaagagagtgtt
gctttgagaataataacagagggtgcttcaattcttcgacaggaaaaaaacttgctggat
atcgatgcaccagtcacagtttgtggggacatccatggacaattttttgacttaatgaag
ctctttgaagtcgggggctctcctgccaacactcgctacctcttcttaggggactatgtg
gacagagggtacttcagtatcgagtgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgtgtatatgacgcctgtatggac
gccttcgactgccttcccctggcggcgctgatgaaccaacagttcctgtgtgtacatggt
ggtttgtctccagagattaacactctagatgacatcagaaaattagaccgattcaaagaa
ccacctgcttatggacccatgtgtgacatcctgtggtcagaccccctggaggactttgga
aatgagaagactcaggagcatttcactcacaacacagtcagggggtgttcctacttctac
agttacccggctgtatgtgaattcttgcagcacaataacttgttatctatactccgagcc
catgaagcccaagatgcagggtaccgcatgtacaggaaaagccaaacaacaggcttcccc
tctctaattacaattttctcagcaccaaattacttagatgtgtacaataacaaagctgca
gtattgaaatatgagaacaatgttatgaatatcaggcagttcaactgttccccccatcca
tactggctcccaaatttcatggatgttttcacctggtcactgccatttgttggagagaaa
gtgactgagatgctggtaaatgtccttaacatctgctcagatgatgaactggggtccgaa
gaagatggatttgatggagccactgctgcagcacggaaggaagtgatacggaacaagatc
cgagcaataggaaaaatggccagagtgttctcggttctcagagaagagagtgagagtgtt
ctgacgctgaaaggcttgaccccaaccggcatgctccccagcggagtgctttctggaggg
aaacaaaccctgcaaagcgctactgttgaggctattgaggctgatgaagctatcaaagga
ttttcaccacagcataagatcactagcttcgaggaggccaagggcttagaccgaattaac
gagcggatgccgccccgcagagacgccctgccctctgacgccaaccttaactccatcaac
aaggctctcgcctcagagactaacggcacggacagcaatggcagtaacagcagcaatatc
cagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734750
Entry
103734750         CDS       T03372                                 

Gene name
Ppp3r1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04114  Oocyte meiosis
ngi04218  Cellular senescence
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04380  Osteoclast differentiation
ngi04625  C-type lectin receptor signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04720  Long-term potentiation
ngi04724  Glutamatergic synapse
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04924  Renin secretion
ngi05010  Alzheimer disease
ngi05014  Amyotrophic lateral sclerosis
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05031  Amphetamine addiction
ngi05152  Tuberculosis
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103734750 (Ppp3r1)
   04310 Wnt signaling pathway
    103734750 (Ppp3r1)
   04370 VEGF signaling pathway
    103734750 (Ppp3r1)
   04020 Calcium signaling pathway
    103734750 (Ppp3r1)
   04022 cGMP-PKG signaling pathway
    103734750 (Ppp3r1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103734750 (Ppp3r1)
   04218 Cellular senescence
    103734750 (Ppp3r1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103734750 (Ppp3r1)
   04650 Natural killer cell mediated cytotoxicity
    103734750 (Ppp3r1)
   04660 T cell receptor signaling pathway
    103734750 (Ppp3r1)
   04658 Th1 and Th2 cell differentiation
    103734750 (Ppp3r1)
   04659 Th17 cell differentiation
    103734750 (Ppp3r1)
   04662 B cell receptor signaling pathway
    103734750 (Ppp3r1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103734750 (Ppp3r1)
   04921 Oxytocin signaling pathway
    103734750 (Ppp3r1)
   04924 Renin secretion
    103734750 (Ppp3r1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103734750 (Ppp3r1)
   04720 Long-term potentiation
    103734750 (Ppp3r1)
  09158 Development and regeneration
   04360 Axon guidance
    103734750 (Ppp3r1)
   04380 Osteoclast differentiation
    103734750 (Ppp3r1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103734750 (Ppp3r1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103734750 (Ppp3r1)
   05014 Amyotrophic lateral sclerosis
    103734750 (Ppp3r1)
   05020 Prion disease
    103734750 (Ppp3r1)
   05022 Pathways of neurodegeneration - multiple diseases
    103734750 (Ppp3r1)
  09165 Substance dependence
   05031 Amphetamine addiction
    103734750 (Ppp3r1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103734750 (Ppp3r1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103734750 (Ppp3r1)
   05170 Human immunodeficiency virus 1 infection
    103734750 (Ppp3r1)
   05163 Human cytomegalovirus infection
    103734750 (Ppp3r1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103734750 (Ppp3r1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103734750 (Ppp3r1)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     103734750 (Ppp3r1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 103734750
NCBI-ProteinID: XP_008832053
LinkDB
Position
Un
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaagcaagttatccgttggaaatgtgctcacactttgatgctgatgaaatt
aaaaggctagggaagagattcaagaagcttgatttggacaattctggttctctgagtgtg
gaagagttcatgtcgttgcctgagttacaacagaaccctttagtacagcgagtaatagac
atatttgacaccgacgggaatggagaagtagactttaaagaattcattgagggagtctct
cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtgttgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gacaaggatggagatggaagaatatcctttgaagaattttgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736944
Entry
103736944         CDS       T03372                                 

Gene name
Ppp3cb
Definition
(RefSeq) protein phosphatase 3 catalytic subunit beta
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04114  Oocyte meiosis
ngi04218  Cellular senescence
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04380  Osteoclast differentiation
ngi04625  C-type lectin receptor signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04720  Long-term potentiation
ngi04724  Glutamatergic synapse
ngi04728  Dopaminergic synapse
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04924  Renin secretion
ngi05010  Alzheimer disease
ngi05014  Amyotrophic lateral sclerosis
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05031  Amphetamine addiction
ngi05152  Tuberculosis
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103736944 (Ppp3cb)
   04310 Wnt signaling pathway
    103736944 (Ppp3cb)
   04370 VEGF signaling pathway
    103736944 (Ppp3cb)
   04020 Calcium signaling pathway
    103736944 (Ppp3cb)
   04022 cGMP-PKG signaling pathway
    103736944 (Ppp3cb)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103736944 (Ppp3cb)
   04218 Cellular senescence
    103736944 (Ppp3cb)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103736944 (Ppp3cb)
   04650 Natural killer cell mediated cytotoxicity
    103736944 (Ppp3cb)
   04660 T cell receptor signaling pathway
    103736944 (Ppp3cb)
   04658 Th1 and Th2 cell differentiation
    103736944 (Ppp3cb)
   04659 Th17 cell differentiation
    103736944 (Ppp3cb)
   04662 B cell receptor signaling pathway
    103736944 (Ppp3cb)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103736944 (Ppp3cb)
   04921 Oxytocin signaling pathway
    103736944 (Ppp3cb)
   04924 Renin secretion
    103736944 (Ppp3cb)
  09156 Nervous system
   04724 Glutamatergic synapse
    103736944 (Ppp3cb)
   04728 Dopaminergic synapse
    103736944 (Ppp3cb)
   04720 Long-term potentiation
    103736944 (Ppp3cb)
  09158 Development and regeneration
   04360 Axon guidance
    103736944 (Ppp3cb)
   04380 Osteoclast differentiation
    103736944 (Ppp3cb)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103736944 (Ppp3cb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103736944 (Ppp3cb)
   05014 Amyotrophic lateral sclerosis
    103736944 (Ppp3cb)
   05020 Prion disease
    103736944 (Ppp3cb)
   05022 Pathways of neurodegeneration - multiple diseases
    103736944 (Ppp3cb)
  09165 Substance dependence
   05031 Amphetamine addiction
    103736944 (Ppp3cb)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103736944 (Ppp3cb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103736944 (Ppp3cb)
   05170 Human immunodeficiency virus 1 infection
    103736944 (Ppp3cb)
   05163 Human cytomegalovirus infection
    103736944 (Ppp3cb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103736944 (Ppp3cb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103736944 (Ppp3cb)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103736944 (Ppp3cb)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     103736944 (Ppp3cb)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 103736944
NCBI-ProteinID: XP_008834813
LinkDB
Position
Un
AA seq 480 aa
MDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFF
DLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHL
TEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLD
RFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
IIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNC
SPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEI
IRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAE
KAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHSAQ
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggatgggatacccagggttgatgttctgaagaaccatctggtgaaagaaggccgggta
gatgaagaaattgcgcttagaattattaatgagggggctgccatactccggagggagaaa
accatgatagaagtagaagctccaattacagtgtgtggtgacatccatggccaatttttt
gatctgatgaaactttttgaagtaggaggatcacctgctaatacacgatacctttttctt
ggtgattatgtggacagaggttattttagtatagagtgtgtcttgtatttgtgggtcttg
aagattctctacccaagcacattattccttctgagaggcaaccacgaatgcagacatctt
actgaatattttacctttaagcaggaatgtaaaattaaatattcagaaagagtctacgaa
gcttgtatggaagcttttgatagcttgccccttgctgcacttttaaaccaacagtttctt
tgcgttcatggtggactttcaccagaaatacacacactggacgatattaggagattagat
agattcaaagagccacctgcatttggaccaatgtgtgacttgctatggtctgatccttct
gaagactttggaaatgaaaaatcacaagaacattttagtcacaacacagttcgaggatgt
tcttatttttataactatccagcagtgtgtgaatttttgcaaaacaataatttgttatcg
attattagagctcatgaagctcaagatgcaggctatagaatgtacagaaaaagtcaaact
acagggttcccttcattaataacaattttttcggcacctaattacttagatgtctacaat
aataaagctgctgttttaaagtatgaaaataatgtgatgaatattcgacagtttaactgt
tctccgcatccttactggttgcccaattttatggatgtcttcacatggtctttaccattt
gttggagaaaaagtgacagaaatgttggtcaatgttctgagtatttgctctgatgatgaa
ctgatgactgagggtgaagaccaatttgatgtaggttcagctgcagcccggaaagaaatc
ataagaaataaaatccgagcaattggcaagatggcaagagtcttctctgttctcagggag
gagagtgaaagtgtgctgacactcaagggcctgactcccacagggatgttgcctagtgga
gtgttggctggaggacggcagaccctgcaaagtgccacagttgaggctattgaggctgaa
aaagcaatacgaggattctctccaccacatagaatctgcagttttgaagaggcaaagggt
ttggataggatcaatgagagaatgccaccccggaaagatgctgtacagcaagatggtttc
aattctctgaacaccgcacatgccactgaaaaccacgggactggcaaccatagtgcccag
tga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747869
Entry
103747869         CDS       T03372                                 

Gene name
Ppp3cc
Definition
(RefSeq) protein phosphatase 3 catalytic subunit gamma
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04114  Oocyte meiosis
ngi04218  Cellular senescence
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04380  Osteoclast differentiation
ngi04625  C-type lectin receptor signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04720  Long-term potentiation
ngi04724  Glutamatergic synapse
ngi04728  Dopaminergic synapse
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04924  Renin secretion
ngi05010  Alzheimer disease
ngi05014  Amyotrophic lateral sclerosis
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05031  Amphetamine addiction
ngi05152  Tuberculosis
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103747869 (Ppp3cc)
   04310 Wnt signaling pathway
    103747869 (Ppp3cc)
   04370 VEGF signaling pathway
    103747869 (Ppp3cc)
   04020 Calcium signaling pathway
    103747869 (Ppp3cc)
   04022 cGMP-PKG signaling pathway
    103747869 (Ppp3cc)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103747869 (Ppp3cc)
   04218 Cellular senescence
    103747869 (Ppp3cc)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103747869 (Ppp3cc)
   04650 Natural killer cell mediated cytotoxicity
    103747869 (Ppp3cc)
   04660 T cell receptor signaling pathway
    103747869 (Ppp3cc)
   04658 Th1 and Th2 cell differentiation
    103747869 (Ppp3cc)
   04659 Th17 cell differentiation
    103747869 (Ppp3cc)
   04662 B cell receptor signaling pathway
    103747869 (Ppp3cc)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103747869 (Ppp3cc)
   04921 Oxytocin signaling pathway
    103747869 (Ppp3cc)
   04924 Renin secretion
    103747869 (Ppp3cc)
  09156 Nervous system
   04724 Glutamatergic synapse
    103747869 (Ppp3cc)
   04728 Dopaminergic synapse
    103747869 (Ppp3cc)
   04720 Long-term potentiation
    103747869 (Ppp3cc)
  09158 Development and regeneration
   04360 Axon guidance
    103747869 (Ppp3cc)
   04380 Osteoclast differentiation
    103747869 (Ppp3cc)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103747869 (Ppp3cc)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103747869 (Ppp3cc)
   05014 Amyotrophic lateral sclerosis
    103747869 (Ppp3cc)
   05020 Prion disease
    103747869 (Ppp3cc)
   05022 Pathways of neurodegeneration - multiple diseases
    103747869 (Ppp3cc)
  09165 Substance dependence
   05031 Amphetamine addiction
    103747869 (Ppp3cc)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103747869 (Ppp3cc)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103747869 (Ppp3cc)
   05170 Human immunodeficiency virus 1 infection
    103747869 (Ppp3cc)
   05163 Human cytomegalovirus infection
    103747869 (Ppp3cc)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103747869 (Ppp3cc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103747869 (Ppp3cc)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103747869 (Ppp3cc)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     103747869 (Ppp3cc)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 103747869
NCBI-ProteinID: XP_008848661
LinkDB
Position
Un
AA seq 519 aa
MSGRHQPLSTTDRVIKAVPFPPTQRLTLKEVFENGKPRMDVLKSHLIKEGRVEEEVALKI
INDGAAILRQEKTMIEVEAPVTVCGDVHGQFFDLMKLFEVGGSPINTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMDTFDC
LPLAALLNQQFLCVHGGMSPEITCLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFFSYPAVCEFLQNNSLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISDDEAEDNYISSYPKGGTSVRKEVIKNKIRAIGKMARVFSILREES
ESVLTLKGLTPTGTLPLGVLSGGKQTIETATVEAVEAQEAIRGFSLPHKIRSFEEARGLD
RINERMPPRKDNGRPDRPVRLVNPAPTNVRKSDQGKKVQ
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgtccgggaggcaccaaccactgtccactaccgaccgcgtcatcaaagctgtcccgttt
cctccaacccagcggcttactttgaaggaagtatttgagaatgggaaacccagaatggat
gttctgaaaagccatttgataaaggaaggccgagtggaagaggaagtagccttgaagata
atcaatgatggggccgccatcctcagacaggagaagactatgatagaggtggaagcgccg
gtcacagtgtgtggtgatgttcatggacagttctttgacctgatgaagttgtttgaagtt
gggggatcacctattaatactcgatacctctttctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtatttatggagtttaaagattaatcatcccaaaacattg
tttctgcttcgaggaaatcatgaatgcagacatcttacagagtacttcaccttcaagcag
gaatgtcggatcaaatactcagagcaggtgtacgacgcgtgcatggatacatttgactgc
cttcctcttgctgcactcttaaaccagcagttcctctgtgtacacggaggaatgtcacct
gaaattacttgtttagatgacattaggaaattagataggtttactgagcctcctgctttc
gggccagtgtgtgacctgctttggtcggatccctcggaggactatggtaatgagaaaacc
ttggagcactatacccacaacaccgtccgagggtgctcttactttttcagttaccctgca
gtttgtgaatttttgcagaacaacagtttattatcaatcatcagagctcacgaagcccag
gatgctgggtaccgaatgtacaggaagagccaagcaaccggctttccgtcacttatcaca
attttctctgcccctaattacctagatgtctataacaataaagctgcagtgttgaaatat
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccctactggctccca
aactttatggatgttttcacgtggtctttgccctttgttggagaaaaagtcacagagatg
ctggttaacattctcaacatctgctctgatgatgaactgatctccgatgatgaggcagaa
gataactacatttcaagctatccgaaaggaggcacttcagttcgaaaagaggtcatcaag
aataaaatcagagccattgggaagatggcacgggtcttttcaattcttcgggaagagagt
gagagtgtgctgactctcaagggcctcactcccacaggcacactccccttgggggtcctc
tctggaggcaagcagaccattgagactgccacagtagaagcggtagaggcccaggaagcc
atcagagggttttcacttccgcacaagatccgaagttttgaagaagctcgaggtctagac
cgaattaatgagagaatgccaccccgaaaagataatgggcgtcctgacaggccagtgaga
ttggtaaacccagcgcccacaaatgtgcgaaagagcgaccaaggaaaaaaagtccagtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103749104
Entry
103749104         CDS       T03372                                 

Gene name
Ppp3r2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04114  Oocyte meiosis
ngi04218  Cellular senescence
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04380  Osteoclast differentiation
ngi04625  C-type lectin receptor signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04720  Long-term potentiation
ngi04724  Glutamatergic synapse
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04924  Renin secretion
ngi05010  Alzheimer disease
ngi05014  Amyotrophic lateral sclerosis
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05031  Amphetamine addiction
ngi05152  Tuberculosis
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103749104 (Ppp3r2)
   04310 Wnt signaling pathway
    103749104 (Ppp3r2)
   04370 VEGF signaling pathway
    103749104 (Ppp3r2)
   04020 Calcium signaling pathway
    103749104 (Ppp3r2)
   04022 cGMP-PKG signaling pathway
    103749104 (Ppp3r2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103749104 (Ppp3r2)
   04218 Cellular senescence
    103749104 (Ppp3r2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103749104 (Ppp3r2)
   04650 Natural killer cell mediated cytotoxicity
    103749104 (Ppp3r2)
   04660 T cell receptor signaling pathway
    103749104 (Ppp3r2)
   04658 Th1 and Th2 cell differentiation
    103749104 (Ppp3r2)
   04659 Th17 cell differentiation
    103749104 (Ppp3r2)
   04662 B cell receptor signaling pathway
    103749104 (Ppp3r2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103749104 (Ppp3r2)
   04921 Oxytocin signaling pathway
    103749104 (Ppp3r2)
   04924 Renin secretion
    103749104 (Ppp3r2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103749104 (Ppp3r2)
   04720 Long-term potentiation
    103749104 (Ppp3r2)
  09158 Development and regeneration
   04360 Axon guidance
    103749104 (Ppp3r2)
   04380 Osteoclast differentiation
    103749104 (Ppp3r2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103749104 (Ppp3r2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103749104 (Ppp3r2)
   05014 Amyotrophic lateral sclerosis
    103749104 (Ppp3r2)
   05020 Prion disease
    103749104 (Ppp3r2)
   05022 Pathways of neurodegeneration - multiple diseases
    103749104 (Ppp3r2)
  09165 Substance dependence
   05031 Amphetamine addiction
    103749104 (Ppp3r2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103749104 (Ppp3r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103749104 (Ppp3r2)
   05170 Human immunodeficiency virus 1 infection
    103749104 (Ppp3r2)
   05163 Human cytomegalovirus infection
    103749104 (Ppp3r2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103749104 (Ppp3r2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103749104 (Ppp3r2)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     103749104 (Ppp3r2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 103749104
NCBI-ProteinID: XP_008850143
LinkDB
Position
Un
AA seq 170 aa
MGNESSYPSQMCAHFDQDEIKRLGKRFKKLDLDKSGALSVDEFMSVARPQQNPLVRRVID
VFDRDGNGEVDFTEFIVGTSQFSVKGDEEEKLRFAFSIYDIDKDGYISNGELFQVLKMMV
GNNLKDWQLQQLVDKTILVLDRDGDGRISFEEFSDVVRGLDVHKKLVVVV
NT seq 513 nt   +upstreamnt  +downstreamnt
atggggaatgagtccagctacccatcccagatgtgtgcccacttcgaccaagatgagatt
aaaaggctgggcaagagattcaagaagttggacttagacaaatcgggcgccctgagcgtg
gacgagttcatgtcggtggcccggccgcagcagaacccgctggtgaggcgagtgatcgat
gtcttcgacagggacggcaacggagaagtggacttcaccgagttcatcgtgggcacctcg
cagttcagtgtcaagggcgacgaggaggagaaactgagattcgccttcagcatctacgac
atagacaaggatggctacatctctaatggagagctcttccaggtgctgaagatgatggtg
ggcaacaacctcaaggactggcagctacagcagctggtggacaaaactattctggtcctg
gatcgggacggtgatggaagaatatcctttgaagagttcagtgatgtggtcagaggcctg
gatgtccacaagaagttggtagtggttgtgtaa

DBGET integrated database retrieval system