KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103728095
Entry
103728095         CDS       T03372                                 

Gene name
Prkacb
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04020  Calcium signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04114  Oocyte meiosis
ngi04140  Autophagy - animal
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04310  Wnt signaling pathway
ngi04340  Hedgehog signaling pathway
ngi04371  Apelin signaling pathway
ngi04530  Tight junction
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04713  Circadian entrainment
ngi04714  Thermogenesis
ngi04720  Long-term potentiation
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04727  GABAergic synapse
ngi04728  Dopaminergic synapse
ngi04740  Olfactory transduction
ngi04742  Taste transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04910  Insulin signaling pathway
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04919  Thyroid hormone signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04961  Endocrine and other factor-regulated calcium reabsorption
ngi04962  Vasopressin-regulated water reabsorption
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04976  Bile secretion
ngi05012  Parkinson disease
ngi05020  Prion disease
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05032  Morphine addiction
ngi05034  Alcoholism
ngi05146  Amoebiasis
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103728095 (Prkacb)
   04014 Ras signaling pathway
    103728095 (Prkacb)
   04310 Wnt signaling pathway
    103728095 (Prkacb)
   04340 Hedgehog signaling pathway
    103728095 (Prkacb)
   04371 Apelin signaling pathway
    103728095 (Prkacb)
   04020 Calcium signaling pathway
    103728095 (Prkacb)
   04024 cAMP signaling pathway
    103728095 (Prkacb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103728095 (Prkacb)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103728095 (Prkacb)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103728095 (Prkacb)
   04540 Gap junction
    103728095 (Prkacb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103728095 (Prkacb)
   04062 Chemokine signaling pathway
    103728095 (Prkacb)
  09152 Endocrine system
   04911 Insulin secretion
    103728095 (Prkacb)
   04910 Insulin signaling pathway
    103728095 (Prkacb)
   04922 Glucagon signaling pathway
    103728095 (Prkacb)
   04923 Regulation of lipolysis in adipocytes
    103728095 (Prkacb)
   04912 GnRH signaling pathway
    103728095 (Prkacb)
   04913 Ovarian steroidogenesis
    103728095 (Prkacb)
   04915 Estrogen signaling pathway
    103728095 (Prkacb)
   04914 Progesterone-mediated oocyte maturation
    103728095 (Prkacb)
   04921 Oxytocin signaling pathway
    103728095 (Prkacb)
   04926 Relaxin signaling pathway
    103728095 (Prkacb)
   04935 Growth hormone synthesis, secretion and action
    103728095 (Prkacb)
   04918 Thyroid hormone synthesis
    103728095 (Prkacb)
   04919 Thyroid hormone signaling pathway
    103728095 (Prkacb)
   04928 Parathyroid hormone synthesis, secretion and action
    103728095 (Prkacb)
   04916 Melanogenesis
    103728095 (Prkacb)
   04924 Renin secretion
    103728095 (Prkacb)
   04925 Aldosterone synthesis and secretion
    103728095 (Prkacb)
   04927 Cortisol synthesis and secretion
    103728095 (Prkacb)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103728095 (Prkacb)
   04270 Vascular smooth muscle contraction
    103728095 (Prkacb)
  09154 Digestive system
   04970 Salivary secretion
    103728095 (Prkacb)
   04971 Gastric acid secretion
    103728095 (Prkacb)
   04976 Bile secretion
    103728095 (Prkacb)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103728095 (Prkacb)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103728095 (Prkacb)
  09156 Nervous system
   04724 Glutamatergic synapse
    103728095 (Prkacb)
   04727 GABAergic synapse
    103728095 (Prkacb)
   04725 Cholinergic synapse
    103728095 (Prkacb)
   04728 Dopaminergic synapse
    103728095 (Prkacb)
   04726 Serotonergic synapse
    103728095 (Prkacb)
   04720 Long-term potentiation
    103728095 (Prkacb)
   04723 Retrograde endocannabinoid signaling
    103728095 (Prkacb)
  09157 Sensory system
   04740 Olfactory transduction
    103728095 (Prkacb)
   04742 Taste transduction
    103728095 (Prkacb)
   04750 Inflammatory mediator regulation of TRP channels
    103728095 (Prkacb)
  09149 Aging
   04211 Longevity regulating pathway
    103728095 (Prkacb)
   04213 Longevity regulating pathway - multiple species
    103728095 (Prkacb)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103728095 (Prkacb)
   04714 Thermogenesis
    103728095 (Prkacb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103728095 (Prkacb)
   05205 Proteoglycans in cancer
    103728095 (Prkacb)
   05203 Viral carcinogenesis
    103728095 (Prkacb)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103728095 (Prkacb)
   05020 Prion disease
    103728095 (Prkacb)
  09165 Substance dependence
   05030 Cocaine addiction
    103728095 (Prkacb)
   05031 Amphetamine addiction
    103728095 (Prkacb)
   05032 Morphine addiction
    103728095 (Prkacb)
   05034 Alcoholism
    103728095 (Prkacb)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103728095 (Prkacb)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103728095 (Prkacb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103728095 (Prkacb)
   05163 Human cytomegalovirus infection
    103728095 (Prkacb)
   05165 Human papillomavirus infection
    103728095 (Prkacb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103728095 (Prkacb)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103728095 (Prkacb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103728095 (Prkacb)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ngi03019]
    103728095 (Prkacb)
   03036 Chromosome and associated proteins [BR:ngi03036]
    103728095 (Prkacb)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103728095 (Prkacb)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: AGC group
  PKA family
   103728095 (Prkacb)
Messenger RNA biogenesis [BR:ngi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103728095 (Prkacb)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103728095 (Prkacb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 103728095
NCBI-ProteinID: XP_008824451
LinkDB
Position
Un
AA seq 351 aa
MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPPPSNAGLEDFERKKTLGTGSFGRVML
VKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFAT
TDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCGKEFCEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggggaacgcggcgaccgccaagaaaggcagcgaggtggagagcgtgaaagaatttcta
gccaaagccaaagaagactttctaaagaaatgggaaaatcctcccccgagtaatgctgga
ctcgaggattttgagaggaaaaaaacccttggaacaggttcatttggaagagtcatgttg
gtgaaacataaagccactgagcagtattatgctatgaagatcttagataagcagaaggtt
gttaaactgaagcaaatagagcatactttgaatgagaaaagaatattgcaggcagtgaat
tttcctttccttgttcgactggagtattcttttaaggataattctaatttatacatggtt
atggaatatgttcctgggggtgaaatgttttcacatctaagaagaattggacggttcagt
gagccccacgctcggttctatgcggcccagatagtgctaacatttgagtacctccattca
ttagatctcatctacagagacctaaagcctgagaatctcctaattgaccaccaaggttat
attcaggtcacagattttgggtttgccaaaagagtcaaaggcagaacttggacattatgt
ggcacaccagagtatctggctccagaaataatcctcagcaagggctacaataaggcggtg
gattggtgggcactaggagtgctaatttatgaaatggcagctggctaccctccgttcttt
gcagatcaaccaattcagatttatgagaagattgtttctggaaaggtccgattcccatcc
cacttcagttctgatctcaaggaccttctacggaacctgctgcaggtggatctgacgaag
cgatttggaaatctgaagaatggtgtgagcgacataaagacccataagtggtttgccaca
actgattggattgctatttaccagaggaaggttgaagctccattcataccaaagttcaga
ggctctggagataccagcaactttgatgactatgaagaagaagatatccgtgtctctata
acagaaaaatgtggcaaagagttttgtgaattctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751850
Entry
103751850         CDS       T03372                                 

Gene name
Prkaca
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04020  Calcium signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04114  Oocyte meiosis
ngi04140  Autophagy - animal
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04310  Wnt signaling pathway
ngi04340  Hedgehog signaling pathway
ngi04371  Apelin signaling pathway
ngi04530  Tight junction
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04713  Circadian entrainment
ngi04714  Thermogenesis
ngi04720  Long-term potentiation
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04727  GABAergic synapse
ngi04728  Dopaminergic synapse
ngi04740  Olfactory transduction
ngi04742  Taste transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04910  Insulin signaling pathway
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04919  Thyroid hormone signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04961  Endocrine and other factor-regulated calcium reabsorption
ngi04962  Vasopressin-regulated water reabsorption
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04976  Bile secretion
ngi05012  Parkinson disease
ngi05020  Prion disease
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05032  Morphine addiction
ngi05034  Alcoholism
ngi05146  Amoebiasis
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103751850 (Prkaca)
   04014 Ras signaling pathway
    103751850 (Prkaca)
   04310 Wnt signaling pathway
    103751850 (Prkaca)
   04340 Hedgehog signaling pathway
    103751850 (Prkaca)
   04371 Apelin signaling pathway
    103751850 (Prkaca)
   04020 Calcium signaling pathway
    103751850 (Prkaca)
   04024 cAMP signaling pathway
    103751850 (Prkaca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103751850 (Prkaca)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103751850 (Prkaca)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103751850 (Prkaca)
   04540 Gap junction
    103751850 (Prkaca)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103751850 (Prkaca)
   04062 Chemokine signaling pathway
    103751850 (Prkaca)
  09152 Endocrine system
   04911 Insulin secretion
    103751850 (Prkaca)
   04910 Insulin signaling pathway
    103751850 (Prkaca)
   04922 Glucagon signaling pathway
    103751850 (Prkaca)
   04923 Regulation of lipolysis in adipocytes
    103751850 (Prkaca)
   04912 GnRH signaling pathway
    103751850 (Prkaca)
   04913 Ovarian steroidogenesis
    103751850 (Prkaca)
   04915 Estrogen signaling pathway
    103751850 (Prkaca)
   04914 Progesterone-mediated oocyte maturation
    103751850 (Prkaca)
   04921 Oxytocin signaling pathway
    103751850 (Prkaca)
   04926 Relaxin signaling pathway
    103751850 (Prkaca)
   04935 Growth hormone synthesis, secretion and action
    103751850 (Prkaca)
   04918 Thyroid hormone synthesis
    103751850 (Prkaca)
   04919 Thyroid hormone signaling pathway
    103751850 (Prkaca)
   04928 Parathyroid hormone synthesis, secretion and action
    103751850 (Prkaca)
   04916 Melanogenesis
    103751850 (Prkaca)
   04924 Renin secretion
    103751850 (Prkaca)
   04925 Aldosterone synthesis and secretion
    103751850 (Prkaca)
   04927 Cortisol synthesis and secretion
    103751850 (Prkaca)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103751850 (Prkaca)
   04270 Vascular smooth muscle contraction
    103751850 (Prkaca)
  09154 Digestive system
   04970 Salivary secretion
    103751850 (Prkaca)
   04971 Gastric acid secretion
    103751850 (Prkaca)
   04976 Bile secretion
    103751850 (Prkaca)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103751850 (Prkaca)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103751850 (Prkaca)
  09156 Nervous system
   04724 Glutamatergic synapse
    103751850 (Prkaca)
   04727 GABAergic synapse
    103751850 (Prkaca)
   04725 Cholinergic synapse
    103751850 (Prkaca)
   04728 Dopaminergic synapse
    103751850 (Prkaca)
   04726 Serotonergic synapse
    103751850 (Prkaca)
   04720 Long-term potentiation
    103751850 (Prkaca)
   04723 Retrograde endocannabinoid signaling
    103751850 (Prkaca)
  09157 Sensory system
   04740 Olfactory transduction
    103751850 (Prkaca)
   04742 Taste transduction
    103751850 (Prkaca)
   04750 Inflammatory mediator regulation of TRP channels
    103751850 (Prkaca)
  09149 Aging
   04211 Longevity regulating pathway
    103751850 (Prkaca)
   04213 Longevity regulating pathway - multiple species
    103751850 (Prkaca)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103751850 (Prkaca)
   04714 Thermogenesis
    103751850 (Prkaca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103751850 (Prkaca)
   05205 Proteoglycans in cancer
    103751850 (Prkaca)
   05203 Viral carcinogenesis
    103751850 (Prkaca)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103751850 (Prkaca)
   05020 Prion disease
    103751850 (Prkaca)
  09165 Substance dependence
   05030 Cocaine addiction
    103751850 (Prkaca)
   05031 Amphetamine addiction
    103751850 (Prkaca)
   05032 Morphine addiction
    103751850 (Prkaca)
   05034 Alcoholism
    103751850 (Prkaca)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103751850 (Prkaca)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103751850 (Prkaca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103751850 (Prkaca)
   05163 Human cytomegalovirus infection
    103751850 (Prkaca)
   05165 Human papillomavirus infection
    103751850 (Prkaca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103751850 (Prkaca)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103751850 (Prkaca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103751850 (Prkaca)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ngi03019]
    103751850 (Prkaca)
   03036 Chromosome and associated proteins [BR:ngi03036]
    103751850 (Prkaca)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103751850 (Prkaca)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: AGC group
  PKA family
   103751850 (Prkaca)
Messenger RNA biogenesis [BR:ngi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103751850 (Prkaca)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103751850 (Prkaca)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 103751850
NCBI-ProteinID: XP_008853637
LinkDB
Position
Un
AA seq 351 aa
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAQLDQFDRIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaggagagcgtgaaagagttccta
gccaaagccaaggaagattttctgaaaaaatgggagagtcctgctcagaatacagcccag
ttggatcagtttgatcgaatcaagacccttggtactggctcctttgggcgggtgatgctt
gtgaaacacaaggagacagggaaccactatgccatgaagatcctggataaacagaaggtg
gtgaagctgaaacagatagagcacaccttgaatgagaaacgcattctacaagctgtcaat
ttcccgttcctggtcagactcgagttctccttcaaggacaactcaaacttgtacatggtc
atggagtatgtgcctggcggggagatgttctcccacctacggcggatcggaaggttcagc
gagccccatgcccgtttctatgcggcgcagatcgtcttgacctttgagtacctgcactcc
ctggacctcatctaccgggacctgaagcccgagaacctgctcatcgaccagcagggctat
attcaggtgacagacttcggttttgccaagcgtgtgaaaggccgtacctggaccttgtgt
gggacccctgagtacttggcccctgagattatcctgagcaaaggttacaacaaggctgtg
gactggtgggctctcggggtcctcatctacgagatggccgctggttacccgcccttcttt
gccgaccagcccatccagatctacgagaaaatcgtctctgggaaggtgcggttcccttcc
cacttcagctcggatttgaaggacctgctgcggaaccttctgcaggtggatctcaccaag
cgtttcgggaacctcaagaatggggttaacgacataaagaaccacaagtggtttgccacg
actgactggattgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacgagtaactttgatgactacgaggaggaagaaatccgggtgtccatc
aatgagaagtgtggcaaggagttttctgagttttag

DBGET integrated database retrieval system