KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103728510Help
Entry
103728510         CDS       T03372                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00052  Galactose metabolism
ngi00500  Starch and sucrose metabolism
ngi01100  Metabolic pathways
ngi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103728510
   00500 Starch and sucrose metabolism
    103728510
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103728510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103728510
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103728510
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103728510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5110
Motif
Other DBs
NCBI-GeneID: 103728510
NCBI-ProteinID: XP_017651964
LinkDB All DBs
Position
Un
AA seq 112 aa AA seqDB search
MALVVALTTSGEAHGELYWDDGESLGVLEQGAYTQVTFQAKNNTITNELVHVSKEGANLQ
LRSVSVVGVTTAPTQVFSNGIPVSNFTYSPDSKILAIPVSLLMGEQFRISWS
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggctctggttgtggccctaacaacaagtggcgaggcccatggggagctgtactgggac
gatggggagagccttggggtgctggagcagggggcctatacacaggtcaccttccaagcc
aagaacaacaccatcacgaatgagttggtacatgtgtccaaagagggggccaacctgcag
ctgaggagtgtgtccgtcgtaggtgtgaccacagcccccacccaggtcttctccaacggt
atccctgtctccaacttcacctacagccctgacagcaagatcctggccatcccagtctcg
ctgctcatgggggagcagtttcgcatcagttggtcctag

DBGET integrated database retrieval system