KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103728734
Entry
103728734         CDS       T03372                                 

Definition
(RefSeq) prolactin-2A1-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103728734
   04151 PI3K-Akt signaling pathway
    103728734
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103728734
   04060 Cytokine-cytokine receptor interaction
    103728734
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103728734
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103728734
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103728734
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103728734
NCBI-ProteinID: XP_017651994
LinkDB
Position
Un
AA seq 228 aa
MQLAWTQPCSSGKLLLWLASTLLLWENVASTPMCAMKKGHCFVTLAELCDRAVNVTQHIS
SQAAGMFSEFDAQYAHGRGRLGGLRMCHTSSLSTPENKKQALQTHPVDLLKLVASLSRAW
SNPLYHLVNKMSTMRGAPTSVVHKAREIIEKIDGLLEGVHKMLYKVMSGYKQDDQYPAWF
GLADLLSPNEEKCILACYKLIRCLRRDLKYVDTYFKVLKCRMFQGNKC
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcagctagcttggactcaaccgtgctcctcaggaaagctgctcctgtggctggcgtcc
acccttctcctctgggagaatgtggcctcgacacccatgtgtgcaatgaagaaaggccac
tgcttcgtgaccttggcggagctgtgtgaccgggcagtcaacgtgactcagcacatcagc
agccaagccgcaggaatgttttctgaatttgatgcgcagtacgcccatggccggggacgc
cttggtggattaagaatgtgccacacttcctccctgtctactccggaaaataagaaacaa
gccctgcagacccatcctgttgatctcctgaaactggtggccagtctatcgagagcctgg
agtaaccctctgtaccatctagtgaataaaatgtctaccatgcgaggagcccccacttct
gttgtccacaaagccagagagattattgaaaaaatcgatggactactggaaggtgttcat
aaaatgctctacaaggttatgagtggatataaacaagatgatcaatacccagcctggttc
ggactggcagacttgctatcacccaatgaagagaaatgcattcttgcttgttataaactg
atccgctgcctgcgcagagatcttaaatatgtggacacttacttcaaggtcctgaagtgc
agaatgttccaaggaaacaaatgctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103728735
Entry
103728735         CDS       T03372                                 

Definition
(RefSeq) prolactin-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103728735
   04151 PI3K-Akt signaling pathway
    103728735
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103728735
   04060 Cytokine-cytokine receptor interaction
    103728735
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103728735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103728735
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103728735
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103728735
NCBI-ProteinID: XP_017651995
LinkDB
Position
Un
AA seq 237 aa
MQPSLMQTCSGKLLLLLVSNLLLCGNANVTSAPTRDKGNRQCNVSLQELFKEAITVSAKI
SKRASVLFAQFDRHYTMKQQFQNRAFGRCHTHSLGAPQTKKDAAELPTKFLMKLMPAILN
AWKKPLYHLVTELSGRHGAPSQIVNMVRYIEEKCVRLQGVVGRIKIKLRLHYEEKKYPEW
SGLAALQSADTKDARFAFYNLLHCLRSDMQKVHNYLHVVKCEAAPDQSCKSHGRHSI
NT seq 714 nt   +upstreamnt  +downstreamnt
atgcagccctccttgatgcaaacatgctcagggaaactgctcctgcttctggtatccaac
ctgctcctgtgtgggaatgcgaatgtgacctctgcacccacacgtgacaaagggaataga
caatgcaacgtgtccttgcaggaactgtttaaggaagcgatcactgtatctgcaaagatc
agtaaaagagcttcagtactgttcgcccagtttgatagacactacaccatgaaacaacaa
ttccagaacagggccttcggcaggtgccacacgcactccctcggtgctcctcaaaccaag
aaggatgctgcagagcttccgacgaaattcctaatgaaattgatgcccgcaatactgaat
gcctggaagaaacctctgtaccatctggtgactgaactgtctgggaggcacggagcccct
tctcagattgtcaatatggtcagatacattgaggaaaaatgtgtaagacttcaaggggtt
gttggccgcataaaaatcaagctacggcttcattacgaagaaaaaaaatacccagaatgg
tccggcctggcagccttgcagtcagctgatacaaaggatgcacgcttcgccttttataac
ttactgcattgcctgcgttcagatatgcaaaaggttcataattatctccacgtagtgaag
tgtgaagcggcccccgaccagtcctgcaaatctcacggaagacactccatctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103728738
Entry
103728738         CDS       T03372                                 

Definition
(RefSeq) prolactin-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103728738
   04151 PI3K-Akt signaling pathway
    103728738
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103728738
   04060 Cytokine-cytokine receptor interaction
    103728738
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103728738
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103728738
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103728738
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103728738
NCBI-ProteinID: XP_017651993
LinkDB
Position
Un
AA seq 183 aa
MSLQDHFRQAVNVSQEIKNQATDLYTLFNKQYAESRGFKYRGITCHTSSFAVLRNVEDTG
KMKPMALLKMVYNLLGSWTIPLQHLAKEVGSLQGAPAALLSKAQEIEKPHKGLLEGVRKL
IRRSGDTENVKYLTWSGLTCLQSTYEETLLFGFYKLFYCLHEDSVKVSTNLKLLEDKMVT
YNC
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtccttgcaagaccactttaggcaggcagtcaatgtgtctcaggaaatcaagaatcaa
gcgacagatttgtacactctgtttaataaacagtatgctgaaagccggggattcaagtac
aggggcatcacctgccacacatcgtcctttgctgttctaagaaatgtggaggatacggga
aagatgaaacctatggccctcctgaaaatggtatacaacctactgggctcctggaccatt
cctctgcagcatctagccaaagaagtgggcagcctacaaggagcccctgctgctctgctc
tctaaagcccaagagattgaaaaaccacacaaaggactcctggagggcgtgaggaagtta
atcagaaggtctggagatacagaaaatgtgaaataccttacctggtctggactgacatgc
ttgcagtcaacatatgaagaaactctcctgtttggattttataaactattctactgccta
cacgaggattcggttaaagtctccactaatctgaagctcctggaggacaaaatggttacc
tacaattgctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103728739
Entry
103728739         CDS       T03372                                 

Definition
(RefSeq) prolactin-2A1-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103728739
   04151 PI3K-Akt signaling pathway
    103728739
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103728739
   04060 Cytokine-cytokine receptor interaction
    103728739
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103728739
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103728739
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103728739
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103728739
NCBI-ProteinID: XP_008824918
LinkDB
Position
Un
AA seq 225 aa
MLLSLSQPCAGTLLLLLVTNVLLGKNTASDPVCYMWSNRCHLSFSDHFSQAVTVSQEIRD
QVTDTFTEFDKQYTQDLEFNDRVPTCHTSSLAVPEKEEEAQQMKPVILLKLTHTLLGAWT
NPLQHLVEEMGSLQGAPAALLSNATEIEENHKGLLEGVRKLIRRVEDKENKNYPAWSGLE
SLQSDNEDTRLFAFYNLFRCLIKDSETATTHLKHLRCQMDPYSEC
NT seq 678 nt   +upstreamnt  +downstreamnt
atgctgctgtctctgagtcaaccatgcgcagggacactgctgctgttgctggtgacgaac
gtgctgctggggaagaacacggcctctgacccggtgtgctacatgtggagcaaccgctgc
cacttgtctttctcagaccacttcagtcaggcggtcactgtgtctcaggaaatcagggac
caagtcacagacacattcactgaatttgataaacaatacacccaggacctggagttcaat
gacagggttcccacctgccacacatcttctctcgctgttccagaaaaggaggaagaagca
cagcagatgaagcctgtcatcctgctgaaactgacacacactctactgggcgcctggacc
aatcctctgcagcatcttgtggaagaaatgggtagtctgcaaggagcccctgctgctctg
ctttctaatgccacagaaattgaagaaaaccacaaaggactcctggagggtgtgaggaag
ttaatcagaagggttgaagataaagaaaacaagaactaccctgcctggtctggactggaa
tccttgcaatcagacaatgaagacactcgcctttttgccttttataacttgttccgatgc
ctgatcaaggactcagaaacagctaccactcatctgaagcacttgaggtgccaaatggac
ccgtacagtgagtgctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103728740
Entry
103728740         CDS       T03372                                 

Definition
(RefSeq) prolactin-5A1-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103728740
   04151 PI3K-Akt signaling pathway
    103728740
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103728740
   04060 Cytokine-cytokine receptor interaction
    103728740
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103728740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103728740
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103728740
SSDB
Motif
Pfam: Hormone_1 DUF2721
Other DBs
NCBI-GeneID: 103728740
NCBI-ProteinID: XP_008824919
LinkDB
Position
Un
AA seq 209 aa
MQLSLTGPCSWTLLLLLLSNLLLWKDVASEPKRNFTDGSCEKILGYIFNLTDTLSEDINS
LSSEMLNEFDKEYDEGQKFRNKASMTCHTYSLHLPNKKRYPERTQPDFLLKATMSMLSAW
NNHLSQVVLRFHDLETTHHGIMSKFRVVDGKISKLRRYLKVVRTVLSQMANESSLPFAFH
SLFVCLHSDATKVSDYINVLRCHMVSSTC
NT seq 630 nt   +upstreamnt  +downstreamnt
atgcagctgtctttgactggaccatgttcttggacacttctgctgttgttgctgtcaaat
ctgctcctgtggaaggatgtggcctctgagcctaagcgcaatttcacagatggaagctgt
gagaagatccttgggtacatttttaacttgacagacaccctatctgaggacatcaatagc
ctctcttcagaaatgttaaatgaatttgataaagagtacgatgaaggccagaagttccgg
aacaaggcctccatgacctgccatacctattccctccatcttccaaacaaaaaacggtac
cctgaaaggacccaacctgacttccttctgaaggctaccatgagtatgttgagtgcctgg
aacaaccatctgtcacaagtagtgctcagatttcatgatctggaaacaacccatcatggt
atcatgtcaaaattcagagtggttgatggaaagatctcaaaactcagaagatacctgaag
gtagttaggactgtactaagccagatggccaatgaaagctctctcccctttgcctttcat
agcctattcgtctgcttgcacagcgatgcaacaaaagtttctgattatattaatgtcctg
agatgtcacatggtctctagcacatgctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103728741
Entry
103728741         CDS       T03372                                 

Definition
(RefSeq) prolactin-5A1-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103728741
   04151 PI3K-Akt signaling pathway
    103728741
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103728741
   04060 Cytokine-cytokine receptor interaction
    103728741
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103728741
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103728741
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103728741
SSDB
Motif
Pfam: Hormone_1 AAA_32
Other DBs
NCBI-GeneID: 103728741
NCBI-ProteinID: XP_008824920
LinkDB
Position
Un
AA seq 246 aa
MGEPMFYNISHVKIGCWGGRNSNAGTLLLLLLSNLLLWEDVALVPLCEEANGQCQLSLGY
FFDQARELSENINVLSSETFKEFDQDFGIGQQVIFKFPMDCHISSVSIPSNATQAHEMQP
TDLLNVTMHMVAAWEVPVKRAVDEMADVEAMPGFSAIITKLRALHDKITKLMQYLQDVKT
LLSQVHLEAEQNENYLAWSGLPYLEMDNKRSRLFVYHTLLRCLNSDAEKIATFVKTLRCQ
MVPSKC
NT seq 741 nt   +upstreamnt  +downstreamnt
atgggggaacccatgttttataatataagccatgtcaaaatcggttgctggggaggtcgt
aactccaatgcagggacacttctgctgctgctgctgtcaaacctgctcctgtgggaggat
gtggccttggtccccttgtgtgaagaggcaaatgggcaatgccagttgtccctcggctac
ttttttgatcaagcacgtgaactctctgagaacatcaacgtcctctcttcagaaaccttc
aaggagtttgatcaagattttgggattggtcagcaggtcatcttcaagttccccatggac
tgccacatttcttccgtttccattccaagtaatgcaacccaagcccatgaaatgcagcct
acggaccttctgaatgtgacaatgcacatggtagctgcctgggaagttcccgtgaagcgt
gcagtggatgaaatggccgatgtggaagccatgcctggtttcagtgctatcataacaaaa
ctccgagcgcttcatgacaaaatcacgaagctcatgcagtatctgcaagatgtgaagact
ttactcagccaggttcatcttgaagctgaacaaaatgagaactaccttgcctggtccgga
ctgccatacttagagatggataacaaaagatcccgtctttttgtctatcacaccctttta
cgctgcctgaactctgatgccgaaaagattgccacctttgtcaagaccctgagatgccaa
atggtccccagtaaatgctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731111
Entry
103731111         CDS       T03372                                 

Gene name
Csf3
Definition
(RefSeq) colony stimulating factor 3
  KO
K05423  granulocyte colony-stimulating factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04657  IL-17 signaling pathway
ngi05144  Malaria
ngi05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103731111 (Csf3)
   04151 PI3K-Akt signaling pathway
    103731111 (Csf3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103731111 (Csf3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103731111 (Csf3)
   04657 IL-17 signaling pathway
    103731111 (Csf3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103731111 (Csf3)
  09174 Infectious disease: parasitic
   05144 Malaria
    103731111 (Csf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103731111 (Csf3)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103731111 (Csf3)
SSDB
Motif
Pfam: GCSF IL11 IL6 Sigma54_AID
Other DBs
NCBI-GeneID: 103731111
NCBI-ProteinID: XP_008827638
LinkDB
Position
Un
AA seq 216 aa
MAQPSAQSHMKLITLQLLLWHSILWMVQTIPLVSASSVPPPLPLPKSFLLKSLEQVRKIQ
AKDEVLLEQLVSKRRQRCATYKLCHPEELALLGHSLGIPQAPLSSCSSQALQLRSCLRQL
HSGLLLYKGLLQALAGISPELALTLDMLQLDVTNFATTIWQQMENLGVAPAVQPTQNTMP
TFASAFQRRAGGVLATSHLQDFLGMAYRALRHFAQP
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcacaaccttctgcccagagccacatgaagctgatcaccctgcagctgctgctgtgg
cacagtattctctggatggtgcagaccattcccctggtctctgccagttctgtgccacca
cccctgcccctacccaagagcttcctactcaagtccttagaacaagtgaggaagatccag
gccaaagacgaggtgctgctggagcagctggtgagtaagaggcggcagaggtgtgccacc
tacaagctgtgccaccctgaggagctggcactgcttggtcactccctgggcatcccacag
gctcccctgagcagctgttccagccaggccctgcagctgaggagctgcctgagacaactc
cacagtggactccttctctacaagggcctcctgcaggctctggcagggatttcccctgag
ctagccctcaccttggacatgctgcagctggatgttaccaactttgccaccaccatctgg
cagcagatggaaaacttaggggtggcccctgccgtgcagcctacccaaaacaccatgcca
acctttgcttctgctttccagcgccgggcaggaggtgtcctggccacctcccacctgcag
gacttcctggggatggcctaccgtgctctgcgtcacttcgcccagccctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732660
Entry
103732660         CDS       T03372                                 

Gene name
Thpo
Definition
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103732660 (Thpo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103732660 (Thpo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103732660 (Thpo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103732660 (Thpo)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103732660 (Thpo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 103732660
NCBI-ProteinID: XP_008829532
LinkDB
Position
Un
AA seq 414 aa
MNETRLFLSHSGYSPDPLPLAHLCPTPLCAEVQELKPPPWPQERFRGEAPFREPLQPDTL
ARMELTDLLLVVTLLLTTRLTLCSPAPPACDPRLLNKLLRDSHVLHSQLSQCPDISPLST
PVLLPAVDFSLGEWKSQTEQTKAQDVLGAVTLLLEGVMAARGQVEPTCLSSLLGQLSGQV
RLLLGALRGLLGTQGRTTAHKDPNAIFLSFQQLLRGKVRFLLLVEGPTLCVRRALPTTAI
PSSTSLLLTLNKLPNRTSGLLEMNFNVSAKTTGPGLLNRLQEFRAKTVPGQLNQTSRSPD
QIPGYWNRAHGPLNGTHGLFAGASPQTLKVPDIPPGALNTGSLPFNFQPGSPPSPTHPPA
GQYTLSPSLPTSSTLGTPPQLHPLVPDPATKVHNSTSPRPITVYSHSQNLSQEA
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgaatgaaactcgactatttctgtcacattcaggatacagtccagaccctcttcccttg
gcccacctgtgccctaccccactctgtgcagaagtgcaagagctcaagccgcctccatgg
ccccaggaaagattcaggggagaggccccattcagggagccactccagccagacaccctg
gccagaatggagctgactgatttgctcctcgtggtcacacttctccttactacaagacta
actctgtgcagcccggctcctcctgcctgtgaccctcgacttctaaataaactgctccgt
gactcccatgtccttcacagccaactgagccagtgcccagacatcagtcctttgtccaca
cctgtcctgttgcctgctgtggactttagcctgggagaatggaaatctcagacggagcag
accaaggcacaggacgttctaggggcagtgaccctactactggagggagtaatggcagcc
cgaggacaggtagaacccacctgcctttcatctctcctgggacagctttctgggcaggtc
cgcctcctcctgggggccttgcggggccttcttggaacccagggcaggaccacagctcac
aaggatcccaatgccatcttcctgagcttccaacaactgctccgaggaaaggtgcgtttc
ctgctgcttgtagaaggtcccaccctctgtgtcaggcgggccctgcccaccacagctatc
ccaagcagtacctccttactcctcacactgaacaagctcccaaacaggacttctggattg
ttggagatgaacttcaatgtctcagccaaaactactggccctggacttctgaacaggctg
caagaattcagagccaagactgttcctggtcaactgaatcaaacttccaggtcccccgac
caaatccccggatactggaacagggcacatggacccttgaatggaactcatggactcttt
gctggagcctcaccccagaccctcaaagtcccagacattccaccaggagctttgaacaca
ggctccctgccattcaacttccagcctggatctcctccttccccaacccatcctcctgct
ggacagtacacactctccccttctttacccacctcgtccacccttgggactccaccccag
ctccaccctctggttcctgatcctgccaccaaagtgcataactctaccagccctcgtcca
atcacagtgtactctcattcccagaatttgtctcaggaagcataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732939
Entry
103732939         CDS       T03372                                 

Definition
(RefSeq) prolactin-3B1-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103732939
   04151 PI3K-Akt signaling pathway
    103732939
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103732939
   04060 Cytokine-cytokine receptor interaction
    103732939
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103732939
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103732939
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103732939
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103732939
NCBI-ProteinID: XP_008829898
LinkDB
Position
Un
AA seq 221 aa
MKLSLTLAHCSGTCLLLLVSNLLLWENVASMPQTQLPAKDLYGRVIFLSHCNHNLATQVY
FEFVEKIARRSGNMGMMFVMCHTASIPTPENREQVQRTKTEDLLKMIIRISLAWEEPLKV
LGQELAALPGASDGMLSNIKTLEERNEAIVEGTETILSRLQPGAVEKEYVAWSGKNDLQS
ADARTRVAALRNVLRCLRRDTHKIDNFFKVLKCRVVRNNNS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaagctgtcattaactctagcacactgctcagggacatgtctgctgctgctggtgtca
aacctgctcctgtgggagaatgtggcctccatgccacagacccagttgcccgctaaggac
ctgtatggacgtgtgatcttcctgtctcattgcaaccataacctagccacacaagtatac
tttgagtttgtagaaaaaattgccaggagaagtgggaacatgggcatgatgtttgtcatg
tgccacacagcttccatcccaactccagagaaccgtgaacaagtgcagaggacaaaaacc
gaagatcttctgaaaatgatcatcagaatttcacttgcctgggaagaacccctgaaagtc
ctggggcaggagctggctgctcttccaggagcttctgatgggatgctgtcaaacatcaag
accttggaggaaagaaatgaagccattgtagagggaacggagaccattctcagcaggctt
cagcctggagctgtggaaaaggagtatgtcgcctggtcgggaaagaatgacctgcagtct
gctgatgcaaggactcgagttgctgctctaaggaacgtgctccgctgcctgcgcagggac
acacataagattgacaatttcttcaaggtcctcaagtgccgagtcgtccgtaacaataac
tcctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103733344
Entry
103733344         CDS       T03372                                 

Gene name
Cntf
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103733344 (Cntf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103733344 (Cntf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103733344 (Cntf)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103733344 (Cntf)
SSDB
Motif
Pfam: CNTF DUF3719
Other DBs
NCBI-GeneID: 103733344
NCBI-ProteinID: XP_008830388
LinkDB
Position
Un
AA seq 200 aa
MAFAEHSPLTLHRRDLCSRSIWLARKIRLDLTALMESYVKHQGLNKNINLDSVDGVPMAS
TDRWSEMTEAERLKENLRAYRVFHVMLARLLEDQRVHFTPTEGDFHQAIHTLLLQVSAFA
YQLEELMMLLEHKIPPNEAVGSPATIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVIS
SHQMGVPAHESSSMSKDKKI
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcttttgcagagcactcaccactgacccttcaccgccgggacctctgtagccgctct
atctggctagcaaggaagattcgtttagacctgactgctcttatggaatcttatgtaaag
catcagggcctgaacaagaatatcaacctagactctgtagatggtgtgccaatggcaagc
actgatcgctggagtgagatgacggaggcagagcgactcaaagagaacctccgggcttac
cgtgtcttccatgtcatgttggcaaggcttttagaagaccagagagtgcatttcacccca
actgaaggtgacttccatcaggccatacacacccttctgctccaagtttctgcctttgcc
tatcagctagaggagctaatgatgcttctggaacacaagatccccccaaatgaggctgtt
gggtctcctgccactattggagatggtggcctctttgagaagaagctgtggggcttgaag
gtgcttcaggagctttcgcagtggaccgtgcggtccatccatgaccttcgtgtcatttct
tctcatcagatgggagtcccagcacatgagagcagttctatgtctaaggacaagaaaata
tag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103733506
Entry
103733506         CDS       T03372                                 

Gene name
Epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04066  HIF-1 signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103733506 (Epo)
   04066 HIF-1 signaling pathway
    103733506 (Epo)
   04151 PI3K-Akt signaling pathway
    103733506 (Epo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103733506 (Epo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103733506 (Epo)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103733506 (Epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103733506 (Epo)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103733506 (Epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 103733506
NCBI-ProteinID: XP_008830557
UniProt: Q6H8S9
LinkDB
Position
Un
AA seq 192 aa
MGVPDCLALPLLVTFLLLSLGLPVLGAPPRLICDSRVLERYILEAKEAENITMGCAEGPR
FNENFTVPDTKVNFYAWKTMGVEEQAVEVWQGLSLLFEAILRAQAVLANSSQPSEMLQLH
VDKAISGLRSLTSLLRALGAQKEAISPPDTTQVIPLRRFTVDTFCKLFRIYSNFLRGKLK
LYTGEACRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggtgcctgactgtctcgcgctgccgctcttggtgacctttctactgctttctctg
ggcctcccagtcctcggtgcccccccacggctcatctgtgacagccgagttttggagagg
tacatcctggaggccaaagaggcagagaatatcacgatgggctgtgcagaaggtcccaga
ttcaatgagaatttcacagtcccagacaccaaagtcaacttctatgcctggaagacgatg
ggggtagaagaacaggctgtagaggtctggcaaggcctgtctctgctctttgaagccatc
ctgcgggcccaggctgtgctagccaattcctcccagccatcagagatgttacaactacat
gtagacaaagccatcagtggccttcgaagcctcacctccttgctacgggcgctgggagca
cagaaggaagccatatcgcctccagacaccacccaagtgattccactccgaagattcaca
gtggatactttctgtaaactcttccgaatctactccaatttcctccggggaaagctgaaa
ttatacacaggggaggcctgcaggagaggggacaggtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739983
Entry
103739983         CDS       T03372                                 

Definition
(RefSeq) prolactin-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103739983
   04151 PI3K-Akt signaling pathway
    103739983
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103739983
   04060 Cytokine-cytokine receptor interaction
    103739983
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103739983
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103739983
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103739983
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103739983
NCBI-ProteinID: XP_008838729
LinkDB
Position
Un
AA seq 227 aa
MSLTQACSSGTILLLLLNLLLWKSVFPTPTCAEEEEEEDCQLSTEELFDRTVFMSQYNYD
LATQISDEFSEKFAKGRGYETTNATTCHTDSVSAPKTNEEVEKTHGKNLLKMMISISRAW
FHPLEGLVNAVTALDGASEDMLARAKKLEEKNAGLLKEIKTLLVRVYPGVEETVYPVFMG
LLELKSDDEDTRLSAFYNLMHCLLRDTHKVNMYLSVLKCRVIQSNNC
NT seq 684 nt   +upstreamnt  +downstreamnt
atgtctttgactcaagcctgttcctcaggtacaattctgctgctgctattaaacctgctc
ctgtggaagagcgtgttccccacaccgacctgtgctgaggaggaggaggaggaagactgc
cagctgtccacagaagagctgtttgaccgcacggttttcatgtctcagtacaactatgat
ctcgccacacaaatatcggatgagtttagtgaaaaatttgccaaaggtcggggatacgaa
accacgaatgccaccacctgtcacacagattccgtctccgctcccaaaaccaatgaggaa
gtcgagaagacacatggcaaaaaccttctgaaaatgatgattagtatttcacgggcctgg
ttccatcctctggaaggcctggtgaacgcagtgacagcccttgatggcgcttctgaagat
atgctggcaagagccaaaaagctggaggagaagaacgctggactgctgaaggaaatcaag
acgttactcgttagggtttatcctggagttgaagaaactgtctaccctgtcttcatggga
cttctagaattgaaatcggacgatgaagatactcgcctttctgccttttataacctgatg
cactgcctactcagggacacacataaggttaacatgtacctcagtgtcctgaagtgccga
gtcattcaaagcaataactgctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739984
Entry
103739984         CDS       T03372                                 

Definition
(RefSeq) prolactin-7C1-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103739984
   04151 PI3K-Akt signaling pathway
    103739984
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103739984
   04060 Cytokine-cytokine receptor interaction
    103739984
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103739984
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103739984
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103739984
SSDB
Motif
Pfam: Hormone_1 His_kinase
Other DBs
NCBI-GeneID: 103739984
NCBI-ProteinID: XP_008838730
LinkDB
Position
Un
AA seq 252 aa
MPRSLTNSSSARVLLLLLVSDLLLWEEVVSVPMHAKDTDHEEVTLQELFDHAITLSQNIS
DLATDMRMEFFTNDFSSKLFNKFMLRSTRDMQFMANTLNTCHTLSINTPETIQEAKEISL
DDFLKMTLSIVQAWNVPLHHLVTELSGMPGAPSVILSRAKDIEAENKELLMRVKKILSKV
HPGIEENVSYPLWSDLAHLQAADEEVRMYTLYKMSYCLRVDMHTVDLYLKLLRCLHVNGD
VCYSTGFGDDAK
NT seq 759 nt   +upstreamnt  +downstreamnt
atgccgcggtctttgactaactcatcctccgcaagggtactcctgctgctgctggtgtca
gacctgctcctgtgggaagaagtggtctctgtgcctatgcatgccaaggacactgaccac
gaggaggtcaccctccaggaactgtttgatcatgccatcacactgtctcagaacattagt
gatcttgctacagacatgcgcatggaatttttcaccaacgacttctcttcaaaattgttc
aataaatttatgttacggtccaccagggatatgcagttcatggccaacactctcaacacc
tgccacactctttccatcaacacgccagagaccatccaggaagccaaagaaatctcactt
gatgactttctgaaaatgacactcagtatagtccaagcctggaatgtccctctgcaccac
ctagtgactgagctcagtggtatgcctggggccccgtctgtgatcctatctagagccaaa
gacatcgaggcggaaaacaaagagcttctaatgcgggtcaagaaaatcctcagcaaggtt
catcctggaattgaagaaaatgtgagctaccctctctggtcggaccttgcacacttgcaa
gcagctgatgaagaagttcgcatgtacactctttataaaatgtcttactgcctgcgtgtt
gacatgcatacagttgacctttatctcaagctcctgaggtgtctgcatgttaatggagac
gtctgctactccacagggtttggagatgatgctaaatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739985
Entry
103739985         CDS       T03372                                 

Definition
(RefSeq) prolactin-7B1-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103739985
   04151 PI3K-Akt signaling pathway
    103739985
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103739985
   04060 Cytokine-cytokine receptor interaction
    103739985
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103739985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103739985
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103739985
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103739985
NCBI-ProteinID: XP_017655471
LinkDB
Position
Un
AA seq 246 aa
MQLSLTQPLSRMFLLFLLPNLLLWENVSSAPKHDRRAGLETLSLRELLDHAVMLSQSLSD
LNMELYMLFLRSDFSSKMFSTFVLQNIKDKVFMAKVLNSCQNFSQNTPATMEEAANLAVE
DLLKLIVRPVCFWKDRLHHAVTALSGMPGVPDELLSKAKDTETKNEELLEVIRWVINKVF
PGIEEKEEHVVHGDLESLQSADEQSRFLALYKVSICLGIDTQAVELYLKLLKCVFFGGRI
CYSLGF
NT seq 741 nt   +upstreamnt  +downstreamnt
atgcagctgtctttgactcagcctctctcccggatgttcctgctgttcttgctgccaaac
cttctcctgtgggagaacgtgtcctccgcacccaagcatgaccgcagagctggccttgaa
acactttccctcagggaattattggatcatgctgtgatgctctctcaaagcctcagtgac
ctcaatatggagctgtacatgttatttctcaggagtgacttttcttcaaaaatgttcagt
acatttgtgttacagaatatcaaggataaggtcttcatggctaaggttctcaatagctgc
caaaatttttctcagaacactccggcgaccatggaggaagcagcaaatctcgcagttgaa
gaccttctgaaactcatcgtgagaccagtgtgcttctggaaggaccgtctgcaccatgcg
gtaacagcgctcagtggtatgccgggagtccctgatgagctcctctcaaaagccaaagac
acagagaccaaaaacgaagagcttctggaggtcatcagatgggtcatcaacaaggttttt
cctggaattgaagaaaaggaggagcatgtggtccacggggatcttgaaagcttacagtca
gcggatgaacagtctcgctttttggctctttataaagtgtccatctgcttggggattgac
acccaggccgttgagctgtacctcaagctcctgaagtgtgtgttctttggtggcaggatc
tgctactccttagggttttga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739987
Entry
103739987         CDS       T03372                                 

Definition
(RefSeq) prolactin-7C1-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103739987
   04151 PI3K-Akt signaling pathway
    103739987
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103739987
   04060 Cytokine-cytokine receptor interaction
    103739987
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103739987
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103739987
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103739987
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103739987
NCBI-ProteinID: XP_017655476
LinkDB
Position
Un
AA seq 172 aa
MYHEFMLMFYKDMDFMGNVYSVCHNFSFYAPANLEEAKKFSVEDFLEAILIQVGTWKHTL
QYLVTELRAMPGAPNEILSRAQGIEAENRELLEVIRLVAMKVDPGIEENDYSVYTEISYL
QEVDEESQFFAVFKLYDCLGVDTYSLELYLKFLRCRLIPDKICNSLGLRDGI
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtaccacgaatttatgttaatgttttacaaggacatggacttcatgggtaatgtttac
agtgtctgtcacaacttttccttctatgctccggcaaacctagaagaagccaaaaagttc
tcagttgaagactttctggaagccatactcattcaagtgggaacctggaagcacaccctg
cagtacctagtgactgagctcagggctatgccgggagcccctaatgaaattctgtcaaga
gcccaaggcattgaagctgaaaacagagagcttctggaagtcatccgactggtagccatg
aaggttgatcccggaatcgaagagaatgactacagcgtctacaccgagatttcgtacttg
caggaagtggatgaagaatctcaattttttgctgtttttaaattgtatgactgcctgggg
gttgacacatattcacttgaactttatctcaagtttctgaggtgtaggcttattcctgac
aaaatatgcaactccttagggcttagagatggtatttga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739988
Entry
103739988         CDS       T03372                                 

Definition
(RefSeq) prolactin-7B1-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103739988
   04151 PI3K-Akt signaling pathway
    103739988
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103739988
   04060 Cytokine-cytokine receptor interaction
    103739988
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103739988
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103739988
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103739988
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103739988
NCBI-ProteinID: XP_017655473
LinkDB
Position
Un
AA seq 246 aa
MQLTLTQPRSWTFLLLFVPSFLLWENVHSASTHDTVGGLRSMNLKELLDMAMLFSGNIGH
LNKQLRKLYFNNVFSAGIFSTIMLNFKKNPEFRGNAIRSCQKFSQETPGNIEEAKRIAVE
DFLKIIVRPLRFWNDTLHHLVSELSIMPEVPTEILSKVEDIKTRNEDLLELIRWIINKVF
PGVEENEMLPVNQDLVHFQTADQNARIATLHKFNFCLGIDTNSIGLYLKLMKCVLTGGKK
CHSIGF
NT seq 741 nt   +upstreamnt  +downstreamnt
atgcagctgactttgactcaaccacgttcctggacattcctgctgctgtttgtaccaagt
tttcttctgtgggaaaatgtgcactctgcatctacacatgacactgtaggtggcctcaga
tctatgaacctcaaggaactattggatatggccatgctgttttctggaaacatcggtcac
ctcaataagcaactgcgtaagttatatttcaacaatgtcttctcagccggaattttcagt
acaattatgttaaactttaaaaaaaatccagagttcaggggtaatgccatcagaagttgc
caaaaattttcccaagaaactccaggaaacattgaggaagccaaaaggatcgcagttgaa
gacttcctgaaaatcatagtcaggcctttgcgcttctggaatgacacgcttcaccatcta
gtgagtgagctcagcattatgcccgaagttcccactgagatcctatcaaaagtcgaagac
attaagaccagaaatgaagatcttctggagcttatcagatggatcatcaataaggttttt
cctggagtagaagaaaatgagatgcttcctgtcaaccaggaccttgtacacttccagaca
gctgatcaaaacgctcgcattgccacacttcacaaattcaacttctgcctgggcattgat
acaaactccattggactttatctcaagctcatgaagtgtgtgctcactggtggcaaaaaa
tgccactccatagggttttga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739989
Entry
103739989         CDS       T03372                                 

Definition
(RefSeq) prolactin-8A9-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103739989
   04151 PI3K-Akt signaling pathway
    103739989
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103739989
   04060 Cytokine-cytokine receptor interaction
    103739989
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103739989
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103739989
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103739989
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103739989
NCBI-ProteinID: XP_017655469
LinkDB
Position
Un
AA seq 192 aa
MELSLGQVHFSGAFLLLLVSNLLLWENVASVPECYSHDGHCVVSTAEMFERAIKQAETFR
SLAADMYEEFTKRYMKLLIKFMDSWTNPLFHFVTELEHMKAPQAILSKAKSMKESSKDLV
ADMKWIMSKVHPDAQMKENYPAWPELSSLLGKNKEGQYLAVFNLVSCLRGDSGKTVSHLK
FLKCRVTTNKDC
NT seq 579 nt   +upstreamnt  +downstreamnt
atggagctgtcattgggccaagttcacttctcaggggcattcctgctgctgctggtgtca
aacctgctcctgtgggagaacgtggcctcggttcccgagtgttacagccacgatggtcac
tgtgtggtatccactgcggaaatgtttgagcgtgccatcaagcaggccgaaactttccgt
agccttgctgcagacatgtacgaagaatttaccaaaaggtatatgaaattgttgatcaaa
ttcatggactcgtggaccaaccctctgtttcattttgtgactgaactggaacacatgaaa
gcccctcaggctatcctctcaaaagccaaaagtatgaaagaaagcagcaaggacctcgtg
gctgacatgaagtggataatgagcaaggttcatcctgatgcacaaatgaaagagaactac
cccgcctggcctgaactttcctctctgttgggaaagaataaagagggtcaatatctggca
gttttcaacctggtcagctgcctgcgtggtgattcagggaagactgtaagccatctcaag
tttctgaagtgccgggtaaccacgaacaaagattgctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739991
Entry
103739991         CDS       T03372                                 

Definition
(RefSeq) prolactin-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103739991
   04151 PI3K-Akt signaling pathway
    103739991
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103739991
   04060 Cytokine-cytokine receptor interaction
    103739991
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103739991
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103739991
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103739991
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103739991
NCBI-ProteinID: XP_008838736
LinkDB
Position
Un
AA seq 231 aa
MRLSLGQPLSWTFLLLLVSNLLLWENADSMAVCPSGEGYCQETLPGMFEDALTVSDYLKN
QTAELLNAFRDDVNYASGRWYHEEASVMGCHTTEMGILLTPEEIAQTEAVLLLKEILTVL
EAWKDPLLQATNKLNSMEDTPTAVVSIAEVVKAKINLLQEGIVRILKKISPVSQETVDIP
VWKGLASLNSDDEDTRVFTFYNLFRCLKRDGSKIDYDLKHLKCQIVQDADC
NT seq 696 nt   +upstreamnt  +downstreamnt
atgcggctgtcccttggtcaacctctgtcctggacattcctgctgctgctggtgtcaaac
ctactcctgtgggagaatgcggactcaatggctgtgtgtccaagcggggagggttactgc
caggagactctcccaggcatgttcgaagatgccctcaccgtgtctgattacctcaagaac
caaacggccgaactgttaaatgcatttagggatgatgttaactacgcatcaggcaggtgg
taccatgaggaggccagcgtcatgggctgccacactacagaaatggggattctgctaact
ccagaggaaatcgcacagacagaagctgtgttgctcctgaaagagatactcactgtcctg
gaagcttggaaagaccctcttcttcaggccacgaataaactgaatagtatggaagatacc
ccaactgctgtcgtatcaatagctgaagttgtcaaggcaaaaatcaatttacttcaggag
ggcattgtgagaatactcaagaagattagtcccgtgtcccaggaaactgtggacatcccg
gtctggaaaggactggcatccttgaattcagatgatgaagacacacgcgtctttactttt
tataatctgttccggtgtctgaaaagggatgggagtaagattgactacgacctcaagcat
ctgaagtgccagatcgtccaggatgccgattgctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744567
Entry
103744567         CDS       T03372                                 

Gene name
Lep
Definition
(RefSeq) leptin
  KO
K05424  leptin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04152  AMPK signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103744567 (Lep)
   04152 AMPK signaling pathway
    103744567 (Lep)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103744567 (Lep)
   04060 Cytokine-cytokine receptor interaction
    103744567 (Lep)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103744567 (Lep)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103744567 (Lep)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103744567 (Lep)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103744567 (Lep)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 103744567
NCBI-ProteinID: XP_008844614
LinkDB
Position
Un
AA seq 167 aa
MYWRPLCQFLWLWSYLFHVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGL
DFIPGLHPILSLSKMDQTLAIYQQILTSLPSRNVMQISNDLENLRDLLHLLASSKSCPLP
QTRGPQKPESLDGVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPSC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtactggagacccctgtgccagttcctgtggctttggtcctatctgttccatgttcaa
gctgtacctatccagaaagtccaggatgacaccaaaaccctcatcaagaccattgtcacc
aggattaacgacatttcacacacacagtcagtgtctgccaagcagagagttactggtttg
gacttcattcctgggctccaccccatcctgagtctgtccaagatggaccagacactggca
atctaccaacagatcctcaccagtctgccttcccgaaatgtgatgcaaatatctaacgac
ctagagaacctccgggaccttctccacctgctggcctcctccaagagctgccccctgccc
cagaccagaggcccacagaagccagagagcttggatggcgttctggaagcctctctctat
tccacagaggtggtggccctgagtaggctgcagggctctctgcaggacatgctgcgacag
ctggacctcagccccagctgctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744748
Entry
103744748         CDS       T03372                                 

Definition
(RefSeq) somatotropin
  KO
K05438  growth hormone
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103744748
   04151 PI3K-Akt signaling pathway
    103744748
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103744748
   04060 Cytokine-cytokine receptor interaction
    103744748
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    103744748
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103744748
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103744748
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103744748
NCBI-ProteinID: XP_008844805
LinkDB
Position
Un
AA seq 218 aa
MTMATGSQTSWLLTFTLLCLPWPQEAGAFPAMPLSNLFANAVLRAQHLHQLAADTYKEFE
RAYIPEGQRYSIQNTQAAFCFSETIPAPTGKEEAQQRSDMELLRFSLLLIQSWLGPVQFL
SRVFTNSLVFGTSDRVFEKLKDLEEGIQALMRELEDGSLRAGQLLKQTYDKFDTNMRSDD
ALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
NT seq 657 nt   +upstreamnt  +downstreamnt
atgacaatggctacaggctctcagacctcctggctcctgaccttcaccctgctctgcctg
ccctggcctcaggaggctggtgccttccctgccatgcccttgtccaatctgtttgccaac
gctgtgctccgagcccagcacctgcatcaactggctgctgatacctacaaagagtttgaa
cgtgcctacatccccgagggacagcgatattccatccagaacacccaggctgccttctgc
ttctcagagaccatcccggcccccaccggcaaggaggaggcccagcagagatccgacatg
gagctgctccgcttctctctcctgctcatccagtcgtggctggggcccgtgcagttcctc
agcagggtcttcaccaacagcctggtattcggcacctcggaccgcgtctttgagaaactg
aaggacctggaagaggggatccaggctttgatgcgggagctggaagatggcagtctccga
gctgggcaactcctcaagcaaacctatgacaagtttgacaccaacatgcgcagcgatgac
gcactgctcaagaactatgggctgctctcctgcttcaagaaggacctgcacaaggctgag
acctacctgcgggtcatgaagtgtcgccgctttgtggaaagcagctgtgccttctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751156
Entry
103751156         CDS       T03372                                 

Definition
(RefSeq) prolactin-3B1-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103751156
   04151 PI3K-Akt signaling pathway
    103751156
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103751156
   04060 Cytokine-cytokine receptor interaction
    103751156
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103751156
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103751156
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103751156
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103751156
NCBI-ProteinID: XP_008852742
LinkDB
Position
Un
AA seq 221 aa
MQLSLTQACSSGSLLLLLVSNMLLWENVVTLPQVQLSTKDLYDRLVVQSHDSHDLALQLY
SEFTQKFMKMSWLREREPVPCHTASIPTPDSREQVHNTTTEDILNVTISTLHAWKDALKN
LVPAMAILKGASDAMLSRVKGVQRKIEILLEGMKAILRKEYPGTEEGAYPAWTGQADLKS
PNEDTRHFALFNVIRCLSRDTHRADNYLKVLRCREIFNNKC
NT seq 666 nt   +upstreamnt  +downstreamnt
atgcagctgtctttgactcaagcatgctcctcagggtcactcctgctgctgctggtgtca
aacatgctcctgtgggagaacgtggtcaccttaccacaggtccagctgtccactaaagac
ctgtatgatcgcttggtcgttcagtctcatgacagccatgatctcgccttgcaactgtac
agtgaatttacacaaaagtttatgaagatgagttggttacgggagagggaaccagtcccc
tgccacacagcttctatccctactccagacagccgcgagcaagtccacaacacaacaact
gaagacattctgaatgtgaccatcagtacgttacatgcctggaaagatgccttgaagaac
ctagtgcctgcaatggctattctcaagggagcctctgatgcaatgctgtcaagagtcaag
ggagttcaaagaaaaattgaaatactcctcgaaggaatgaaggcaattctcagaaaggag
taccctggcactgaagaaggcgcctatcctgcttggaccggacaggcagacttgaagtcg
cccaacgaggacactcgccactttgctcttttcaacgtgattcgctgcctgagcagggac
acgcacagggctgacaactacctcaaggtcctgaggtgccgcgagatctttaacaacaag
tgctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751328
Entry
103751328         CDS       T03372                                 

Definition
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103751328
   04151 PI3K-Akt signaling pathway
    103751328
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103751328
   04060 Cytokine-cytokine receptor interaction
    103751328
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103751328
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103751328
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103751328
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103751328
NCBI-ProteinID: XP_008852937
LinkDB
Position
Un
AA seq 230 aa
MISVMNSQGSAQKAGTLLLLVVSNLLFCQNVHPLPICPSGDCKMSLQDMFDRLVMLSHYI
HSLSSEIFIEFDQRYAQGRGFIAKAINGCHTSSLPTPEDKEQAQQIPPEVLLKLVISLLH
AWNDPLYQLVTEVGGIHEAPDGMVSRAKEIEAQIKQLLEGIQKIIGQVHPGANENEIYSV
WAQLPSLQAADEESRLFAFYNLLHCLRRDSHKVDNYLKILKCRIVYQNNC
NT seq 693 nt   +upstreamnt  +downstreamnt
atgatctctgtcatgaacagccagggctcagcacagaaagcagggacactgctgctgcta
gtggtgtcaaacctgctgttctgtcagaacgtgcacccgctgcccatctgtcccagtggg
gactgcaagatgtccctccaggacatgtttgaccgcctggtcatgctgtctcattacatc
catagcctctcttcagaaatattcatcgaatttgatcaacgttatgcccaaggccgtgga
ttcattgccaaggccatcaatggctgccacacttcttctctccctacgccagaggacaaa
gaacaagcccaacagatccccccggaagtcctgctgaaactggtaatcagcttgttgcat
gcctggaacgaccctctttaccaactagtgactgaagttggtggtatccatgaagcccct
gatggtatggtgtcaagagccaaagaaattgaggcacaaatcaaacaactcctggaggga
attcagaagataattggccaggtccatccaggagccaatgaaaatgagatctactctgtg
tgggcacaacttccatccctgcaggcagctgatgaagaatcccggctctttgccttttac
aacctgctccactgcctgcgcagggactcccacaaggttgacaattatctcaagatcctt
aagtgccgaattgtctatcaaaacaactgctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 108490016
Entry
108490016         CDS       T03372                                 

Definition
(RefSeq) prolactin-3B1-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108490016
   04151 PI3K-Akt signaling pathway
    108490016
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108490016
   04060 Cytokine-cytokine receptor interaction
    108490016
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    108490016
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    108490016
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   108490016
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 108490016
NCBI-ProteinID: XP_017650265
LinkDB
Position
Un
AA seq 194 aa
MQLPLTQACSWSFLLLLASHLLLWENAASMPRVQLSTKDLYERLIIQSHHNHGLAILVYS
EFAEKFMKLSWFWEKDPVPCHTASIPTPSSREEVLNRTTENILNVTISTFHAWRDAMRDL
VPAVAALEGASDEYPGTEEGAYPAWTGQADLKSPNEDTRHFALFNMIRCLSRDTHRADNY
LKVLRCREVFNNAC
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcagctgcctttgactcaagcatgctcctggtcatttctcctactgctggcgtcacac
ctgctcctctgggagaatgcggcctccatgccacgggtccagttgtccactaaggacctg
tatgaacgtttgatcattcagtctcaccacaaccatggccttgccatactggtgtacagt
gagtttgcagaaaagtttatgaaactgagttggttctgggaaaaggatccagtcccctgc
cacacggcttccatccctacaccaagcagccgtgaagaagtcctcaacagaactacggaa
aacattctgaatgtgaccatcagcactttccatgcctggagagacgccatgagggaccta
gtgcctgcagtggctgctctggaaggggcctctgatgagtatcccggcactgaagaaggc
gcctatcccgcttggaccggacaggcagacttgaagtcgcccaacgaggacactcgccac
tttgctcttttcaacatgattcgctgcctgagcagggacacgcacagggctgacaactac
ctcaaggtcctgaggtgccgggaggtctttaacaatgcgtgctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 108491197
Entry
108491197         CDS       T03372                                 

Definition
(RefSeq) prolactin-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108491197
   04151 PI3K-Akt signaling pathway
    108491197
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108491197
   04060 Cytokine-cytokine receptor interaction
    108491197
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    108491197
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    108491197
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   108491197
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 108491197
NCBI-ProteinID: XP_017655470
LinkDB
Position
Un
AA seq 233 aa
MQLSSGQPCFSGALLLLLSTLWLWKNVTSAPECHSKDASCEVSLQELFDSAISQSKKIRD
LSTTMWYIFLTRSYNSQRFQERTTKAMNDCHGSFLENPDTEKEVKEIQSDVLLNVTLRMV
GAWNTALQHLTKEMGGVLSIPPALSIFSLAKEIQEKNQELLDDIYRIQRKVYPGFQEDKN
YPVWSELASLQSTEENSRFLAAYNLVECLYFDMYDIKDNLNLLRCLIIPNNNC
NT seq 702 nt   +upstreamnt  +downstreamnt
atgcagctgtcatctggccaaccatgcttctcaggggcactcctactgctgctgtcaacc
ctctggctgtggaagaatgtcacctctgctcctgagtgtcacagcaaagatgcaagctgt
gaggtttctcttcaggaactgtttgacagtgctatcagccagtctaaaaagatccgtgac
ctttctactacaatgtggtacatatttttgaccaggagctacaattcacaaagattccaa
gaaaggacgacaaaggccatgaacgactgccatggttctttccttgagaatccagacact
gagaaggaggtcaaagagattcaatctgatgttctactgaatgtgacacttagaatggtt
ggtgcctggaacactgctcttcagcatttaacaaaggaaatgggtggtgtgctaagtatc
ccgcctgctcttagtatcttctcattggccaaagaaattcaggaaaaaaaccaagaactt
ctagatgacatttataggatacagaggaaggtttatcctggatttcaagaagataagaac
tatcctgtctggtcggaacttgcatccttgcagtcgacagaagaaaactcacgttttctt
gctgcttataatctggtggaatgcctttattttgatatgtatgacattaaggataatctc
aatctcttgagatgcttgatcatcccgaataataactgctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 108491199
Entry
108491199         CDS       T03372                                 

Definition
(RefSeq) prolactin-3B1-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108491199
   04151 PI3K-Akt signaling pathway
    108491199
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108491199
   04060 Cytokine-cytokine receptor interaction
    108491199
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    108491199
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    108491199
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   108491199
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 108491199
NCBI-ProteinID: XP_017655472
LinkDB
Position
Un
AA seq 198 aa
MGENVVTLPQVQLSTKDLYDRLVVQSHDNHDLALQVYSEFTQKFMKVSWLQYRKPIPCHT
ASIPTPDSREQVHNTKTEDILKVTISTFHAWKDAMKDLVPAVVALEGASDAMLSRVKAVQ
EKNEVLLEGMKVILSKEYPGIEEGAYPAWTGQADLKSPNEDTRHFALFNVIRCLSRDTHR
ADNYLKVLRCREVYSNAC
NT seq 597 nt   +upstreamnt  +downstreamnt
atgggggagaacgtggtcaccttaccacaggtccagctgtccactaaagacctgtatgat
cgcttggtcgttcagtctcatgacaaccatgacctcgccttgcaagtgtacagtgagttt
acacaaaagtttatgaaggttagttggttacagtacaggaagccaatcccctgccacaca
gcttctattcctactccagacagccgcgagcaagtccacaacacaaaaactgaagacatt
ctcaaagtgaccatcagtactttccatgcttggaaagatgccatgaaggacctagtgcct
gcagtcgttgctcttgaaggagcctctgatgcgatgctgtcaagagtcaaggcagtgcaa
gaaaaaaatgaagtgctcctcgaaggaatgaaggtgattctcagcaaggagtaccctggc
attgaagaaggcgcctatcccgcttggaccggacaggcagacttgaagtcgcccaacgag
gacactcgccactttgctcttttcaacgtgattcgctgcctgagcagggacacgcacagg
gctgacaactacctcaaggtcctaaggtgccgtgaggtctatagcaatgcgtgctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 108491200
Entry
108491200         CDS       T03372                                 

Definition
(RefSeq) prolactin-3D4-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108491200
   04151 PI3K-Akt signaling pathway
    108491200
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108491200
   04060 Cytokine-cytokine receptor interaction
    108491200
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    108491200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    108491200
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   108491200
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 108491200
NCBI-ProteinID: XP_017655474
LinkDB
Position
Un
AA seq 222 aa
MQLSLTQACSWALLLVVSSFLLWQNVASTSMDQMSTTDLYNLLVRKSSDNRNRVSLLYRE
YGQTYANRSWYREDHPCHTGALLTSEIKQRLQYTKDDDVLQEMIFVTNCWKILLKQAVLA
VAHLPGRTVTLLMRASAAQDTNEVILEALRTISKKLQLEEEKTVNASWMELSELKSPNEI
TRRLTLFNVLRCLYRDTRNFNTYIQVLTQRSRCLHSQLYVSY
NT seq 669 nt   +upstreamnt  +downstreamnt
atgcagctgtcattgactcaagcatgctcctgggcactcctgctggtagtgtcaagcttt
ctcctctggcagaatgtggcctccacctcaatggatcagatgtccacaacagacttgtac
aatcttcttgtccgcaaatcctcagacaaccgtaatcgtgtctcattactataccgtgag
tatgggcaaacatatgccaaccgaagttggtacagggaagaccacccttgccacactggt
gccctccttacatcagagatcaaacagcgtctccagtacacaaaagatgatgatgttctg
caagagatgatatttgttacaaattgctggaaaatcctcctgaaacaggcagtgttggca
gtggctcatcttccaggacgcactgttactttgctgatgagagccagtgcagcacaggac
acaaatgaagtaattctggaggccttgaggaccatttccaaaaagcttcagcttgaagaa
gaaaagactgtcaatgcttcctggatggaactgtcagaactgaagtctcctaatgaaata
actcggcgcttaacactttttaatgtgctgcgctgcctgtacagggacacacgtaacttc
aacacttatatccaggtcctcacgcaaagatctcgatgcctacattcacagttatacgtc
agctactga

DBGET integrated database retrieval system