KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103728739
Entry
103728739         CDS       T03372                                 

Definition
(RefSeq) prolactin-2A1-like
  KO
K05439  prolactin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04080  Neuroactive ligand-receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103728739
   04151 PI3K-Akt signaling pathway
    103728739
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103728739
   04060 Cytokine-cytokine receptor interaction
    103728739
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103728739
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103728739
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103728739
NCBI-ProteinID: XP_008824918
LinkDB
Position
Un
AA seq 225 aa
MLLSLSQPCAGTLLLLLVTNVLLGKNTASDPVCYMWSNRCHLSFSDHFSQAVTVSQEIRD
QVTDTFTEFDKQYTQDLEFNDRVPTCHTSSLAVPEKEEEAQQMKPVILLKLTHTLLGAWT
NPLQHLVEEMGSLQGAPAALLSNATEIEENHKGLLEGVRKLIRRVEDKENKNYPAWSGLE
SLQSDNEDTRLFAFYNLFRCLIKDSETATTHLKHLRCQMDPYSEC
NT seq 678 nt   +upstreamnt  +downstreamnt
atgctgctgtctctgagtcaaccatgcgcagggacactgctgctgttgctggtgacgaac
gtgctgctggggaagaacacggcctctgacccggtgtgctacatgtggagcaaccgctgc
cacttgtctttctcagaccacttcagtcaggcggtcactgtgtctcaggaaatcagggac
caagtcacagacacattcactgaatttgataaacaatacacccaggacctggagttcaat
gacagggttcccacctgccacacatcttctctcgctgttccagaaaaggaggaagaagca
cagcagatgaagcctgtcatcctgctgaaactgacacacactctactgggcgcctggacc
aatcctctgcagcatcttgtggaagaaatgggtagtctgcaaggagcccctgctgctctg
ctttctaatgccacagaaattgaagaaaaccacaaaggactcctggagggtgtgaggaag
ttaatcagaagggttgaagataaagaaaacaagaactaccctgcctggtctggactggaa
tccttgcaatcagacaatgaagacactcgcctttttgccttttataacttgttccgatgc
ctgatcaaggactcagaaacagctaccactcatctgaagcacttgaggtgccaaatggac
ccgtacagtgagtgctaa

DBGET integrated database retrieval system