KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103728977
Entry
103728977         CDS       T03372                                 

Gene name
Rock1
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04270  Vascular smooth muscle contraction
ngi04350  TGF-beta signaling pathway
ngi04360  Axon guidance
ngi04510  Focal adhesion
ngi04530  Tight junction
ngi04611  Platelet activation
ngi04670  Leukocyte transendothelial migration
ngi04810  Regulation of actin cytoskeleton
ngi04921  Oxytocin signaling pathway
ngi05135  Yersinia infection
ngi05163  Human cytomegalovirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103728977 (Rock1)
   04071 Sphingolipid signaling pathway
    103728977 (Rock1)
   04024 cAMP signaling pathway
    103728977 (Rock1)
   04022 cGMP-PKG signaling pathway
    103728977 (Rock1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103728977 (Rock1)
   04530 Tight junction
    103728977 (Rock1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103728977 (Rock1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103728977 (Rock1)
   04670 Leukocyte transendothelial migration
    103728977 (Rock1)
   04062 Chemokine signaling pathway
    103728977 (Rock1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103728977 (Rock1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103728977 (Rock1)
  09158 Development and regeneration
   04360 Axon guidance
    103728977 (Rock1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103728977 (Rock1)
   05206 MicroRNAs in cancer
    103728977 (Rock1)
   05205 Proteoglycans in cancer
    103728977 (Rock1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103728977 (Rock1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103728977 (Rock1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103728977 (Rock1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103728977 (Rock1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103728977 (Rock1)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   103728977 (Rock1)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103728977 (Rock1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 APH Pkinase_C
Other DBs
NCBI-GeneID: 103728977
NCBI-ProteinID: XP_008825185
LinkDB
Position
Un
AA seq 1354 aa
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRSLSSANPNDNRTSSNV
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKMMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
MQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTD
KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLLEEVKHLKHNLERVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQETNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEERAAREKAEDRVVQIEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLTLLLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLRKIQELQSEKETLSTQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEKNSILNKDIELLKKENE
ELNEKMRTAEEEYKLKKEEEINNLKAAFEKNISTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKEFNDMQAQLVEECTHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNIPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQGEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTAGKTS
NT seq 4065 nt   +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcggtttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcggattgtttgttggatggactggatgctttggtttatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttctaagcagatataaa
gacacaataaataaaattagagatttacgaatgaaagctgaagactatgaagtagtgaaa
gtgattggtagaggtgcatttggagaagtacagttggtaaggcataaatctaccagaaag
gtatatgctatgaagcttcttagcaaatttgaaatgattaagagatctgattctgctttt
ttctgggaagaaagagacatcatggcttttgccaacagtccttgggttgttcagcttttt
tatgcattccaggatgaccgatacctctacatggtgatggaatacatgccaggtggagac
cttgtgaatttgatgagtaactatgacgtgcctgagaaatgggcacggttctatactgca
gaagtagttcttgcattggatgcaatccattccatgggttttattcatagagatgtgaag
cctgacaacatgctgctggataaatctggacatttgaagttagcagattttggtacttgt
atgaagatgaacaaggaaggcatggtacgatgtgatacagcagttggaacacctgactat
atttcccctgaagtattaaaatcccaaggtggtgatggttattatggacgagagtgtgac
tggtggtcagttggggtatttttatatgagatgcttgttggtgatacacctttttatgca
gattctcttgttgggacttacagtaaaattatgaaccataaaaattcacttactttccct
gatgataatgacatatcaaaagaagcaaaaaatcttatttgtgccttccttactgacaga
gaagtgagattaggcagaaatggtgtagaagaaatcaaacgacatctcttcttcaaaaat
gatcagtgggcttgggaaacactccgggacactgtagcaccagttgtacctgatttaagt
agtgacattgatactagtaattttgatgacttagaagaagataaaggagatgaagaaaca
tttcctattcctaaagcttttgttggcaatcaactaccttttgtaggatttacatattac
agcaatcgtagatccttatcttcagcaaatcccaatgataacagaactagctccaatgtg
gataaaagcttgcaggaaagtttgcaaaaaacaatctacaagcttgaagaacagctgcat
aatgaaatgcagttaaaggatgaaatggaacaaaagtgcagaacttcgaacataaaactc
gacaagatgatgaaagaattggatgaagaggggaatcaaagaagaaatctagaatctaca
gtgtcccaaattgagaaggaaaagatgttgctacaacacagaattaatgagtaccaaaga
aaagctgaacaggaaaacgagaagaggagaaatgtagaaaatgaagtttctacattaaag
gaccagttggaagacttgaagaaagtaagtcagaactcacagcttgctaatgagaagctg
atgcaattgcaaaaacagctagaagaagccaatgacttacttaggacagaatcagacaca
gctgtaagattaaggaagagtcacacagaaatgagcaaatcaattagtcagctagagtcc
ctgaacagagaattgcaggagagaaaccgaattctagagaattccaagtcacaaacagac
aaggattattaccaactgcaagctgtattggaagctgagcgaagagacagaggtcatgat
tctgaaatgattggagaccttcaagctcgaattacatctttactagaggaggtgaagcat
ctcaaacataatcttgaacgagtagaaggagaaagaaaagaggctcaagacatgcttaat
cattcagaaaaggaaaagaataatttagagatagatttaaactacaagctcaaatcatta
caacagcggttagaacaagagacaaatgaacacaaagtaaccaaagctcgtttaactgac
aaacatcagtctattgaagaggcaaagtctgttgccatgtgtgagatggaaaaaaagctg
aaggaagagagagcagctcgagagaaggctgaggacagagttgttcagatcgagaaacag
tgttctatgctagatgttgatctgaaacagtctcagcagaagctagaacatttgactgaa
aataaagaaaggatggaggacgaagttaagaatctaaccctactgctggagcaagaatca
aataaacgactgttgttacagaatgaattgaagactcaagcatttgaggcagacaattta
aaaggtttagaaaagcagatgaaacaggaaataaatactttgttggaagcaaagagattg
ttagaatttgaattagcccagcttacaaagcaatatagaggaaatgaagggcagatgcgg
gaattacaagaccaactagaagctgaacagtatttctcaacactttataaaacccaggta
aaggaacttaaagaagaaattgaagaaaaaaacagagaaaatttaaggaaaatacaggaa
cttcagagtgaaaaagaaactctttctactcagttggatctagcggaaacaaaagcggag
tctgagcagttagctcgaggacttctggaagaacagtattttgaattgacccaggaaagt
aagaaagctgcttcaagaaatagacaagagattacagataaagatcacactgttagtcgg
cttgaagaaaaaaacagcatactaaacaaagatattgaattattaaaaaaggaaaatgaa
gagctaaatgaaaaaatgaggacagcagaagaagaatataaattgaagaaggaagaagaa
atcaataatcttaaggctgcctttgaaaagaatatcagtactgaacgaacccttaaaaca
caggctgttaacaaattggcagaaataatgaatcgcaaagattttaaaatagatagaaag
aaagctaatacacaagatttgaggaaaaaagaaaaggaaaatcgaaagctgcagttggaa
cttaatcaagaaagagagaaatttaaccaaatggtagtgaaacatcaaaaggaatttaat
gacatgcaagcgcaattggtagaagaatgtacacatagaaatgaacttcagatgcaattg
gctagcaaagaaagtgacattgagcagttgcgggcaaaacttttggacctttcggattct
actagtgttgctagttttcctagtgctgatgaaacggatggaaacataccagagtcaaga
attgaaggttggctttctgtaccaaatagaggaaatatcaaaagatatggctggaagaaa
cagtatgttgttgtaagcagcaaaaaaatcttattctataatgatgaacaagataaggaa
caatccaatccatctatggtgttggacatagataaattatttcatgttcgacctgtaacc
caaggcgatgtgtacagagctgaaactgaagaaattcctaaaatattccagatactatat
gcaaatgaaggtgaatgtagaaaagatgtagaaatggagccagttcaacaaggtgaaaaa
acgaacttccagaatcacaaaggccatgagttcattcctacactctaccacttccctgcc
aactgtgaggcctgtgccaaacctctctggcatgtttttaagccaccccctgccctagag
tgtcgaagatgccatgttaaatgccacagagatcacttagataagaaagaggacttaatt
tctccatgcaaagtaagttacgatgtaacatcagcaagagacatgctgctgttagcatgt
tctcaggatgaacaaaaaaaatgggtgactcatctggtaaagaagatccctaagaatcct
ccatctggctttgttcgtgcctctcctcgaacgttatctactagatccactgcaaatcag
tctttccggaaagtggtcaaaaatacagctggaaaaactagttaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747607
Entry
103747607         CDS       T03372                                 

Gene name
Rock2
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 2
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04270  Vascular smooth muscle contraction
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04510  Focal adhesion
ngi04530  Tight junction
ngi04611  Platelet activation
ngi04670  Leukocyte transendothelial migration
ngi04810  Regulation of actin cytoskeleton
ngi04921  Oxytocin signaling pathway
ngi05132  Salmonella infection
ngi05135  Yersinia infection
ngi05163  Human cytomegalovirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103747607 (Rock2)
   04071 Sphingolipid signaling pathway
    103747607 (Rock2)
   04024 cAMP signaling pathway
    103747607 (Rock2)
   04022 cGMP-PKG signaling pathway
    103747607 (Rock2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103747607 (Rock2)
   04530 Tight junction
    103747607 (Rock2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103747607 (Rock2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103747607 (Rock2)
   04670 Leukocyte transendothelial migration
    103747607 (Rock2)
   04062 Chemokine signaling pathway
    103747607 (Rock2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103747607 (Rock2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103747607 (Rock2)
  09158 Development and regeneration
   04360 Axon guidance
    103747607 (Rock2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747607 (Rock2)
   05205 Proteoglycans in cancer
    103747607 (Rock2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103747607 (Rock2)
   05135 Yersinia infection
    103747607 (Rock2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103747607 (Rock2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103747607 (Rock2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103747607 (Rock2)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103747607 (Rock2)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   103747607 (Rock2)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103747607 (Rock2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 APH
Other DBs
NCBI-GeneID: 103747607
NCBI-ProteinID: XP_008848327
LinkDB
Position
Un
AA seq 1388 aa
MSRAPRTGKMPGAPEAVPGDGAGAGRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIKQHPFFKNDQWN
WENIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFSYFRENL
LLSDSPSCRENDAVQTRKSEESQEIQKKLYTLEEHLNTEMQAKEELEQKCKSMNTRLEKT
VKELEEEITLRKNAESVLRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
EDLKKRNQNSQISTEKVNQLQKQLDEANALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFLNLQSALESERRDRTHGSEIINDLQGRISGLEEDLKTGKT
LLAKVELEKRQLQEKLTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKTTKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERSLKQKVENLLLEAEKKCSLLDCDLKQSQQKLNELLK
QKEMLNEDVRNLTLKIEQETQKRCLMQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN
LEKQNSELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEESEEKTKLCKELQQK
KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDATIGSLEETNRTLTSDVANLANEKEELNNKLKDAQEQLSKLKDEEINAAAIKAQF
EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGSDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHVGLDSSSIGSGPG
DAEPDDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEPEFPVEPVGEKSNYICHKG
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
ISSAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
QLAPNKPS
NT seq 4167 nt   +upstreamnt  +downstreamnt
atgagccgggccccgcggacggggaaaatgcccggcgcccccgaggccgtgccgggggac
ggggcaggcgcgggccgccagaggaagctggaggcgctcatccgagaccctcgctcaccc
atcaacgtggagagcctgctggatggcttaaattccttggtccttgatttggattttcct
gccttaaggaaaaataagaatatagataatttcttaaatagatatgagaaaattgtaaaa
aaaatcagaggtttacaaatgaaggcagaagactatgatgttgtaaaagttattggaaga
ggtgcttttggtgaagtccagttggttcgtcataaggcgtcacagaaggtttatgctatg
aagcttcttagtaagtttgaaatgataaaaagatcagattctgcttttttctgggaagaa
agagatattatggcctttgccaatagtccctgggtggttcagctcttttgtgcctttcaa
gatgacaggtatctgtacatggtaatggaatacatgccaggtggagaccttgtaaacctt
atgagtaattatgatgtgcctgaaaaatgggccaaattttacactgctgaagttgtgctt
gcactggatgcaatacactctatgggtttaatacacagagatgtgaagcctgataatatg
ctcttggataaacacggacatctaaaattagcagattttggcacatgtatgaagatggat
gaaacaggcatggtgcattgtgatacagcagttggaacacctgattacatatcacccgag
gttctgaaatcacaagggggtgatggttattatggacgagaatgtgattggtggtctgta
ggtgttttcctttttgagatgctagtgggggacactccattttatgcagattcacttgta
ggaacctatagcaaaattatggatcataaaaattcactgtgtttccctgaggatgcagaa
atctctaaacatgcgaagaatctcatctgtgccttcttaacggatagggaggtacgactt
gggagaaatggggtagaagaaatcaaacaacaccctttttttaagaatgatcagtggaat
tgggaaaacataagagagacggcagctccagtagtgcctgagctcagcagtgacatagac
agcagcaactttgacgacatagaagatgacaaaggagatgtagagaccttcccaattcct
aaagcttttgtgggaaatcagctgccttttattggatttagctactttagagaaaattta
ttattaagtgactctccatcttgtagagaaaatgatgcagtgcaaacaaggaaaagtgaa
gaaagtcaggagatccagaaaaaattgtatacactagaagaacacctgaacactgagatg
caagccaaggaagagctggaacagaagtgcaaatctatgaatactcgcctagagaaaaca
gtaaaggagctagaagaagagattaccttaaggaaaaatgcagaatcagtattaagacag
ttggaaagagaaaaggcccttcttcagcacaaaaatgcagaataccaacggaaagctgat
catgaagctgacaaaaaacgaaatttggaaaatgatgttaacagcttaaaagatcaactt
gaagacttgaaaaaaagaaatcagaactcccaaatatccactgagaaagtaaatcaactc
cagaaacaactggatgaagctaacgctttgctaagaacagagtctgatactgcagcacgg
ttaagaaaaacccaggcagaaagttccaaacagattcagcagctggaatctaacaataga
gatctccaagataaaaactgcttgctggagactgcgaagttaaaacttgaaaaggaattt
ctcaatcttcagtcagctcttgaatctgaaaggagggaccggacccatggatcagagata
attaatgatttacaaggtagaatatctggcctagaagaagatttaaaaactggcaaaacc
ttactagcaaaggtagagctggagaagagacaactacaggagaagctcaccgatttggaa
aaggaaaagagcaacatggaaatagatatgacatatcaactaaaagttatacagcagagt
ttagaacaagaagaagctgagcacaagaccacaaaagcacggctagcagataaaaataag
atctatgaatccattgaagaagctaaatcagaagccatgaaagaaatggagaagaagctc
ttggaggaaaggtctttaaaacagaaagtggagaacctactattggaggctgagaaaaaa
tgctctctattggactgtgacctcaaacagtcacagcagaaactaaatgaactgcttaaa
cagaaagagatgctaaatgaagatgttagaaatttgacattaaagatagagcaggagact
cagaaacgttgccttatgcaaaatgacctgaagatgcaaacccagcaagttaacacatta
aaaatgtcagagaagcagttaaaacaagagaataatcatctcatggaaatgaaaatgaac
ttggaaaagcaaaattctgaacttcgaaaagaacgtcaagatgcagatgggcaaatgaag
gagttgcaagatcaacttgaagcagagcaatatttctcgaccctctataaaacacaagtt
agagaacttaaagaagaaagtgaagaaaagactaaactttgtaaagaattacaacagaaa
aaacaagaattacaggatgaaagagactctttggctgcccagctagaaatcaccttgacc
aaagcagattctgagcagctggctcgttcaattgctgaggaacaatactctgatttggaa
aaagagaaaatcatgaaagagctagagatcaaagagatgatggctagacacaaacaagaa
cttactgaaaaagatgctacaattggatctcttgaagaaacaaataggacactaactagt
gatgttgcgaatcttgcaaatgagaaagaagaattaaacaacaaattaaaggatgctcaa
gagcaactgtcgaagttgaaagatgaggaaataaatgcagcagctattaaagcacagttt
gagaagcagctgttgacggagagaacactcaagactcaagctgtgaataagttggctgag
atcatgaatcgaaaagaacctgtcaaacgtggtagtgacacagatgtgcgaagaaaagag
aaagagaatagaaagctacatatggagcttaaatctgaacgtgaaaaactgacgcagcag
atgatcaagtatcaaaaggagctgaatgaaatgcaggcccaaatagctgaagagagccaa
attcgaattgagctccagatgacactggacagtaaggacagtgacattgagcagctccgg
tcacagctccaggccttgcacgttggtttggatagttctagtataggcagtggacctggg
gatgctgagccagacgatggatttccagaatcaagattagaaggatggttatcactgcct
gtgagaaacaacactaaaaagtttggatgggttaaaaagtatgtgattgtaagcagtaag
aagattcttttctatgacagtgaacaagataaagaacaatcaaatccttatatggtttta
gacatagacaagctgtttcatgtccgaccagttacacagacagatgtatacagagcagat
gctaaggaaattccaaggatattccagattctatatgccaatgaaggagaaagtaagaag
gaaccagaatttccagtggagccagtgggagaaaagtctaattacatttgccacaaagga
catgaatttatccctactctttatcacttcccaaccaactgtgaggcttgtatgaagcca
ttgtggcacatgtttaaaccccctcctgctctagagtgccgtcgatgccatattaaatgc
cataaagatcacatggacaaaaaggaggagattatagcaccttgcaaagtttattatgat
atttcatcggcaaagaatctgttgttattggcaaattctacagaagaacagcagaaatgg
gttagtcggttagtgaaaaagatacctaaaaagcctccagcaccagatccttttgcacgg
tcatctcccagaacctcaatgaagatacagcaaaaccagtctatccgtcggcccagtcga
cagcttgctccaaacaaaccaagctaa

DBGET integrated database retrieval system